DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and NBPF11

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001095133.3 Gene:NBPF11 / 200030 HGNCID:31993 Length:865 Species:Homo sapiens


Alignment Length:914 Identity:179/914 - (19%)
Similarity:347/914 - (37%) Gaps:233/914 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 WSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELASTLQK---------LDARELEFN 606
            ||.::|.: ::|.:|            ::...|||:.||:..:..::         |..|:.:: 
Human     8 WSSEKAEM-NILEIN------------EKLRPQLAENKQQFRNLKERCFLTQLAGFLANRQKKY- 58

  Fly   607 AKFEECKHL-SMKLQNYKDMLQQIKEQNLKSETNHEEQRRQ---MAELYEQKLTDLRKKVRDSQD 667
             |:||||.| ...|:|.:    |.||:.|..:....|:.||   :....|::||.||:|:|:.:|
Human    59 -KYEECKDLIKFMLRNER----QFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRD 118

  Fly   668 TNRRMTMEIKEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELHAEKVKLETKL 732
            .:|.:...::.:.|..:...|..:..||......|..:.::::|:.|   |:|...|.|::|...
Human   119 ASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPE---NDEDEDEDVQVEEDE 180

  Fly   733 QLKENET-QEV-RAECHRLERELQLAECRCQLAES-SLATQVSPYETAPGSLTELNAIEDQLRAD 794
            ::.|:.. :|| :||..::..: .|.||....:.| .....:.|::.     .::...||::.:.
Human   181 KVLESSAPREVQKAEESKVPED-SLEECAITCSNSHGPCDSIQPHKN-----IKITFEEDKVNSS 239

  Fly   795 LLAAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHSSRKQEGETVGDMLERQNEKLE 859
            |:..:||.:  .|..|.|..|...             .||.|                       
Human   240 LVVDRESSH--DGCQDALNILPVP-------------GPTSS----------------------- 266

  Fly   860 DKLAAVREQMIVER--QAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKVQNASDEAQ 922
                |....|:|..  .::..|.:::.::.::|...|:|||...|.:   :::....|.|...|:
Human   267 ----ATNVSMVVSAGPLSSEKAEMNILEINEKLCPQLAEKKQQFRSL---KEKCFVTQVACFLAK 324

  Fly   923 RMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHRQW-EKAEQERMKCKSEIIEHLANVHRLEQ 986
                      :|.:.:.||.|..:    :.:|:..||: |:...|::|...|:.::...||..|:
Human   325 ----------QQNKYKYEECKDLI----KSMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQER 375

  Fly   987 QETELRQKLRQIQSRFDGVTLEQKNTIRELQEEREKSRKANDSCLVL----QKELKQLTDNFQRL 1047
            :.|:||:|||                     |.|:.||..|:....|    :.:..|..|..::|
Human   376 ELTQLREKLR---------------------EGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQL 419

  Fly  1048 KYACSITDSQLTEVETMLKSEQERNKSQKSQLDTLHEKLRERNDQLTDLRKQLTTVESEKRLAEQ 1112
            ...|.:...                         |.:||...||...|...|:...|..::.:..
Human   420 AEGCRLAQH-------------------------LVQKLSPENDNDDDEDVQVEVAEKVQKSSSP 459

  Fly  1113 RAQVLASE-------IDELRL-----------NLKEQQKKLVAQQDQLVEQTNALFATQERAELL 1159
            |....|.|       ::|..:           |...::.|:..::|: |:.|  |..:....|..
Human   460 REMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDK-VDST--LIGSSSHVEWE 521

  Fly  1160 DGQNANYEAQTADSNREMV------SLKE-ENARILSELFHKKEEVGNLQAE-IRGLESAQANLH 1216
            |..:...|.::.|...|..      :|:| |...:..|.:.:.....::..| :...:|..:..|
Human   522 DAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLSIPPERLASYQSYSSTFH 586

  Fly  1217 AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSA---KKKKTLADKLFGSSH 1278
            :         .|::|..:..||      .:|:    :.|:|.||..|   :..:.|.|:      
Human   587 S---------LEEQQVCMAVDI------GRHR----WDQVKKEDQEATGPRLSRELLDE------ 626

  Fly  1279 TNKENVSPNDVESSI--------LYRALKEELKREQKMNSLLKEQLAQLNGTATLRSPRKSAAVN 1335
              ||   |..::.|:        :|..|.:..:..:....:|::|  ::.....:....|...|.
Human   627 --KE---PEVLQDSLDRCYSTPSVYLGLTDSCQPYRSAFYVLEQQ--RIGLAVDMDEIEKYQEVE 684

  Fly  1336 GDSDAPKQRPVSIAALPRSPQKQQQPLKRTTS----QVELKTTAEKPTKVTIENQAHHRFELALQ 1396
            .|.|....|........:.|:..|..|.|..|    .:||....: |.:..:.:.......|||.
Human   685 EDQDPSCPRLSRELLAEKEPEVLQDSLDRCYSTPSGYLELPDLGQ-PYRSAVYSLEEQYLGLALD 748

  Fly  1397 ESKV 1400
            ..::
Human   749 VDRI 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357
S_TKc 113..383 CDD:214567
Smc 487..1222 CDD:224117 143/719 (20%)
CNH 1503..1774 CDD:279162
NBPF11NP_001095133.3 SbcC <11..>401 CDD:223496 106/497 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 12/41 (29%)
DUF1220 181..240 CDD:399619 12/64 (19%)
DUF1220 450..511 CDD:399619 10/63 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 450..475 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..567 8/46 (17%)
DUF1220 540..596 CDD:399619 9/64 (14%)
DUF1220 609..671 CDD:399619 13/74 (18%)
DUF1220 682..747 CDD:399619 13/65 (20%)
DUF1220 757..821 CDD:399619
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 829..865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.