DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and wts-1

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_492699.1 Gene:wts-1 / 172896 WormBaseID:WBGene00007047 Length:908 Species:Caenorhabditis elegans


Alignment Length:426 Identity:135/426 - (31%)
Similarity:215/426 - (50%) Gaps:93/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CREGLLDAFCLLYNECDKDTLKKRDRNIAEFV-------------NKFRPIIEE-------TRKL 106
            |:..:|..:...:.|......|:|::.:.:..             ||...::::       .|:.
 Worm   431 CKPNMLRFYMEQHVERLLQQYKEREKRMKQLEKEMVSAQLPDIMRNKMLGLLQQKESKYTRLRRQ 495

  Fly   107 RVNADDFLIKTLIGQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQ----VKEERDIMSIRNSE 167
            :::...|.:.:.||.|.||.|.||.:..|..:||||.::|:.|...|    ||.||||::..:|.
 Worm   496 KMSKSHFTVISHIGVGAFGKVSLVRKNDTRKVYAMKSLEKADVIMKQQAAHVKAERDILAEADSP 560

  Fly   168 WLINLQYAFQDNDNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRD 232
            |::.|.::|||:..||.:|||:||||:::|:.:.|.|:|||||||:|||..|:..:|.:|::|||
 Worm   561 WIVRLFFSFQDDACLYFIMEYVPGGDMMTLLIQKGIFEEDLARFYIAELACAIEYVHNVGFIHRD 625

  Fly   233 IKPENILIDRFGHIKLADFG------------------------------NAAALDRDGHVLSL- 266
            :||:|||||:.|||||.|||                              ..||:|:...||:: 
 Worm   626 LKPDNILIDQHGHIKLTDFGLCTGLRWTHDRRYYGPENDHHRVDSFSLPPEVAAIDKSVKVLNVR 690

  Fly   267 ---------SPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICETTPFHE 322
                     |.|||.:|:|||:        ::|:.|:    .|||:||.|:|.||::....|||:
 Worm   691 QQTRRITAHSLVGTGNYMAPEV--------IAKTGHN----QSCDWWSTGVILYEMVFGRVPFHD 743

  Fly   323 DNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRLSYE---------RIK 378
            |....|..:|      .:.:..:.|.....:|.....:|:.|:.:.|.||...         ::|
 Worm   744 DTPGGTQHRI------KNWRNFLDFTYCGNLSKECLMMIQQLICDASSRLGSHGKDVAERTAQVK 802

  Fly   379 NHPFFSEIPWGSIRSQVPP--IIPTVRSDDDTSNFE 412
            |||:|..|.|.::|.....  .||.|..|:||||||
 Worm   803 NHPWFRGIDWVNLRKLRADYIYIPRVTHDEDTSNFE 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 127/357 (36%)
S_TKc 113..383 CDD:214567 113/322 (35%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
wts-1NP_492699.1 STKc_LATS 500..868 CDD:270749 127/357 (36%)
S_TKc 502..807 CDD:214567 113/322 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.