DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and Lats1

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_034820.1 Gene:Lats1 / 16798 MGIID:1333883 Length:1129 Species:Mus musculus


Alignment Length:470 Identity:153/470 - (32%)
Similarity:217/470 - (46%) Gaps:119/470 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CDKDT----LKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYFGNVHLVVERQTND 137
            |.|::    ||:...:.:.||.                    |||| |.|.||.|.|..:..|..
Mouse   685 CQKESNYIRLKRAKMDKSMFVK--------------------IKTL-GIGAFGEVCLARKVDTKA 728

  Fly   138 IYAMKKI-KKSVVTTSQ---VKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLM 198
            :||.|.: ||.|:..:|   ||.||||::..::||::.|.|:|||.||||.||:|:||||::||:
Mouse   729 LYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLL 793

  Fly   199 SRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFG----------- 252
            .|.|.|.|:|||||:||||.|:.::|:||::||||||:||||||.|||||.|||           
Mouse   794 IRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDS 858

  Fly   253 ------------------------NAAALDR-----------DGHVLSLSPVGTPDYIAPELLQT 282
                                    |....||           ....|:.|.||||:|||||:|..
Mouse   859 KYYQSGDHPRQDSMDFSNEWGDPSNCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLR 923

  Fly   283 ISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISF 347
            ....:|            ||:||:|:|.:|::....||......||..|:::.....|:      
Mouse   924 TGYTQL------------CDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHI------ 970

  Fly   348 PADLKVSVNYRNLIESLVTNPSKRL---SYERIKNHPFFSEIPWGS-IRSQVPPIIPTVRSDDDT 408
            |...|:|....:||..|...|..||   ..:.||.||||..|.:.| :|.|....||.:....||
Mouse   971 PPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDT 1035

  Fly   409 SNFE----DGIRHKTRREQGVAK--KSLTTNMKSND-----------FSGKDLPF-----IGYSF 451
            |||:    |.:......|:.::.  .....|.|..:           |.....|:     |.|.:
Mouse  1036 SNFDPVDPDKLWSDGSEEENISDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEY 1100

  Fly   452 VHMEKSAISATTDEK 466
            :|.:.|...:..|::
Mouse  1101 IHSQGSEQQSDEDDQ 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 144/416 (35%)
S_TKc 113..383 CDD:214567 123/322 (38%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
Lats1NP_034820.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
UBA_like_SF 103..143 CDD:304366
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..407
PPxY motif 1 372..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 432..492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..630
Interaction with YAP1. /evidence=ECO:0000250 525..654
PPxY motif 2 555..558
STKc_LATS1 702..1083 CDD:270775 142/419 (34%)
S_TKc 704..1009 CDD:214567 125/343 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1104..1129 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.