DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and LOC101883269

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:XP_021326563.1 Gene:LOC101883269 / 101883269 -ID:- Length:206 Species:Danio rerio


Alignment Length:207 Identity:84/207 - (40%)
Similarity:126/207 - (60%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 MEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLAD 250
            ||:||||||::|.|.: ...|:.|:||.||:.:||..:|.:|::||||||:|:|:||.||.||||
Zfish     1 MEFMPGGDLVTLTSNY-DIPEEWAQFYTAEVVLALDAIHSLGFIHRDIKPDNMLLDRNGHFKLAD 64

  Fly   251 FGNAAALDRDGHVLSLSPVGTPDYIAPELLQTI-STYKLSKSMHDVSRIVSCDYWSMGIIGYELI 314
            ||....:|..|.|...:.|||||||:||:|.:. .|....:         .||:||:|:..|||:
Zfish    65 FGTCTKMDSTGLVSCDAAVGTPDYISPEVLMSQGGTGYYGR---------ECDWWSVGVFIYELL 120

  Fly   315 CETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRL---SYER 376
            ...|||:.:::..||.||:.|      |..::||.|:::|.:.::||.:.:::...||   ....
Zfish   121 VGDTPFYSESLVGTYGKIMDH------KNSLTFPDDIEMSKDAKDLICAFLSSREMRLGRTGVNE 179

  Fly   377 IKNHPFFSEIPW 388
            ||.||||....|
Zfish   180 IKCHPFFKNDQW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 84/207 (41%)
S_TKc 113..383 CDD:214567 81/200 (41%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
LOC101883269XP_021326563.1 PKc_like <1..200 CDD:328722 84/207 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.