Sequence 1: | NP_001261768.1 | Gene: | sti / 39429 | FlyBaseID: | FBgn0002466 | Length: | 1858 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326563.1 | Gene: | LOC101883269 / 101883269 | -ID: | - | Length: | 206 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 84/207 - (40%) |
---|---|---|---|
Similarity: | 126/207 - (60%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 MEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLAD 250
Fly 251 FGNAAALDRDGHVLSLSPVGTPDYIAPELLQTI-STYKLSKSMHDVSRIVSCDYWSMGIIGYELI 314
Fly 315 CETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRL---SYER 376
Fly 377 IKNHPFFSEIPW 388 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sti | NP_001261768.1 | PKc_like | 111..452 | CDD:304357 | 84/207 (41%) |
S_TKc | 113..383 | CDD:214567 | 81/200 (41%) | ||
Smc | 487..1222 | CDD:224117 | |||
CNH | 1503..1774 | CDD:279162 | |||
LOC101883269 | XP_021326563.1 | PKc_like | <1..200 | CDD:328722 | 84/207 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D759391at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |