DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and stk38b

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:XP_017208958.1 Gene:stk38b / 100332206 ZFINID:ZDB-GENE-081031-2 Length:469 Species:Danio rerio


Alignment Length:397 Identity:124/397 - (31%)
Similarity:202/397 - (50%) Gaps:69/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RKLRVNADDFLIKTLIGQGYFGNVHLVVERQTNDIYAMKKIKKSVV----TTSQVKEERDIMSIR 164
            ::.|:..|||....:||:|.||.|.||.::.|..:||||.::|:.:    ..:.::.||||:...
Zfish    80 KRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLQKEQVAHIRAERDILVQA 144

  Fly   165 NSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYV 229
            :|.|::.:.|:|||..||||:||::||||:::|:.:.....|:..:||:||..:|:..:|::|::
Zfish   145 DSLWVVKMFYSFQDKLNLYLLMEFLPGGDMMTLLMKKDTLTEEETQFYVAETVLAIDFIHQLGFI 209

  Fly   230 HRDIKPENILIDRFGHIKLADFG----------------------------------NAAALDRD 260
            ||||||:|:|:|..||:||:|||                                  .|....|:
Zfish   210 HRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSQSNDLTFQHMNSKRKAETWKRN 274

  Fly   261 GHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNV 325
            ...|:.|.||||||||||:.......||            ||:||:|:|.||::....||..:..
Zfish   275 RRQLAFSTVGTPDYIAPEVFMQTGYNKL------------CDWWSLGVIMYEMLIGYPPFCSETP 327

  Fly   326 HETYSKILSHCEESHLKELISFPADLKVSVNYRNLIESLVTNPSKRL---SYERIKNHPFFSEIP 387
            .|||.|::.      .||.:.||.::.:|...:.||.........|:   ..:.||.:.||..:.
Zfish   328 QETYKKVMG------WKETLVFPPEVPISERAKELILRFCCEADHRIGAGGVDDIKRNAFFEGVD 386

  Fly   388 WGSIRSQVPPIIPTVRSDDDTSNFED----GIRHKTRREQGVAKKSLTTNMKSNDFSGKDLPFIG 448
            :..||.:...|...::|.||||||::    .|...|      :...::.:...:|:..||..||.
Zfish   387 YDHIRERPAAITIEIKSIDDTSNFDEFPDSDILQPT------SPVVVSNHHPESDYKNKDWVFIN 445

  Fly   449 YSFVHME 455
            |::...|
Zfish   446 YTYKRFE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 122/385 (32%)
S_TKc 113..383 CDD:214567 100/310 (32%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
stk38bXP_017208958.1 PKc_like 87..465 CDD:304357 123/390 (32%)
S_TKc 89..382 CDD:214567 100/310 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.