DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG3281

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:429 Identity:92/429 - (21%)
Similarity:154/429 - (35%) Gaps:107/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CRACLVLLGPQDACHNLDSEQDLASKYYGCTGEDAVRDL-----PPQLVLKSICECCYQLVQKFH 99
            ||.||.........|:.....||..:.:...  :||..|     .|.|.: .:|:.|.:.:...:
  Fly    15 CRVCLETHETNLYVHDEIKYNDLKLELWQLL--EAVSKLKWTWTDPNLPM-HLCQNCARRLIGAY 76

  Fly   100 DFQRMCAESLRNFEKLLQDIDIGCHKLEDHTWHDL-------DTPSESNESTNPEAQSHA----- 152
            :|......:....:.|.:..::.....|.|.  |:       |..|.:...:...|:.|.     
  Fly    77 EFIVEVENAHETLQNLFEQQEVAAKPDEVHV--DVVELIDQDDVVSMAQYLSTSFAEQHVEMEEK 139

  Fly   153 ----PCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAK-----------QDL 202
                .|.|.|.::.                        ||.:|..||...:           .::
  Fly   140 YGDQDCSAFTSDVG------------------------EEPLYASEDRDDEPEDSFQLKPRPDEI 180

  Fly   203 GQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQ-HE---------------GL 251
            ...:||..|: ||:|.........:|.:|.|.|.|...|..|..| |:               |.
  Fly   181 ENRELSRPSQ-LGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGT 244

  Fly   252 RPYTCVHCAKSYARANLLESHLRQMHNNA----------DAARIIYA----CPSCNKVYTANRSL 302
            ...||.||.:::.|.:.|..|::..|.:|          ::||...|    ||.|...:..: ||
  Fly   245 GLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVS-SL 308

  Fly   303 KYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYC-CECCDRRFYTKE 366
            ..|:||     |..::|   :.|::|.|.|.|...|:.|...|   .|.|.. |:.|.::|.::.
  Fly   309 TIHIRR-----HTGDNP---YKCDQCEKAFPRSQDLSLHMRQH---TGERPSECKICSKKFISQN 362

  Fly   367 NMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRKH 405
            .:..|:....|.:.  ..|:.|.:.|..|.:|..|.|:|
  Fly   363 KLARHMRLHTGQRP--YSCKMCSKSFVQSNDLKIHMRRH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 15/79 (19%)
C2H2 Zn finger 228..248 CDD:275368 8/20 (40%)
C2H2 Zn finger 256..313 CDD:275368 19/70 (27%)
C2H2 Zn finger 289..314 CDD:275368 8/24 (33%)
zf-C2H2 323..345 CDD:278523 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 4/20 (20%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/79 (19%)
C2H2 Zn finger 205..226 CDD:275368 8/20 (40%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 29/110 (26%)
C2H2 Zn finger 296..315 CDD:275368 8/24 (33%)
zf-H2C2_2 307..330 CDD:290200 10/30 (33%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 7/25 (28%)
C2H2 Zn finger 351..371 CDD:275368 4/19 (21%)
zf-H2C2_2 364..388 CDD:290200 5/25 (20%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 4/9 (44%)
C2H2 Zn finger 407..424 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.