DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and pzg

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster


Alignment Length:426 Identity:79/426 - (18%)
Similarity:133/426 - (31%) Gaps:102/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGMDGCDGAKTMICRACLVLLGPQDACHNLDSEQDLASKYYGCTGEDAVRDLPPQLVLKSICECC 91
            ||..|..|..|. |..|      .|.|....|..|:.:.:......:.:..|..:..|..:|...
  Fly    71 SGGVGIGGLATR-CYIC------DDRCEPQTSLTDMCTTHTSTKFPNKLAQLVGEGFLVIVCGED 128

  Fly    92 YQLVQKFHDFQRMCAESLRNFEKLLQDIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIA 156
            |...:        |...:..:::|..|::    :::.:....|:.....||....|...      
  Fly   129 YVCSR--------CTNLVNYYDRLENDVE----RVKTNLISLLNKKYAINEDMGQEGSP------ 175

  Fly   157 ATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDL------------GQEKL-- 207
                           ||.:   :..:|.|....:    :||...||            ||.|:  
  Fly   176 ---------------PLKM---QKMVGGSANRSL----EESPSADLLRPRKLLQGNPVGQSKIAP 218

  Fly   208 -SISSKLLGARK-RRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYT--CVHCAKSYARANL 268
             :..|.:.|.:. :|......:|..|.   ||.|.:......:|..:..|  |..|.|.:.....
  Fly   219 GTTQSSVQGTQTVQRKATKIYKCTSCD---YKTSDMRLFNTHYETCKQQTFQCKTCRKIFPHFGA 280

  Fly   269 LESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTH---------ERYHESESPDAR-- 322
            ::.|:.:.||.|    :...|..|:..:....||:.||...|         .....|.:|.|.  
  Fly   281 MKQHMVRDHNTA----MDNTCAMCHINFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAA 341

  Fly   323 ----------------HICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDH 371
                            :.|..|......|.....|...|.:.:.:.:.|..|.:||.|:|....|
  Fly   342 AAAAAAANENLVGTSLYTCNHCQFKSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVH 406

  Fly   372 LLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRKHKA 407
            ..:...|   ..:|..|...|.....|..|...|::
  Fly   407 AKQHQTN---FFKCGTCSMTFPKREMLVKHFEVHQS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 11/75 (15%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 14/65 (22%)
C2H2 Zn finger 289..314 CDD:275368 7/33 (21%)
zf-C2H2 323..345 CDD:278523 4/21 (19%)
C2H2 Zn finger 325..345 CDD:275368 4/19 (21%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 6/24 (25%)
C2H2 Zn finger 268..289 CDD:275371 4/20 (20%)
C2H2 Zn finger 297..318 CDD:275371 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
zf-H2C2_2 373..399 CDD:290200 6/25 (24%)
zf-C2H2_8 375..443 CDD:292531 16/68 (24%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.