DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG30020

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:79/183 - (43%) Gaps:21/183 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHC 259
            ||..|  |.:.::.:.|..  .|.|.|.:|  :|.||:..:...:||:.||::|.. |...|..|
  Fly  1097 DELGK--LVKHEMELHSNT--ERSRWGYQH--KCAICNTSYRTLTLLKFHMKRHSN-RKSQCKLC 1154

  Fly   260 AKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHI 324
            .||:.....||.|.:..|:.....|..  ...|.|.:    :.|:|:.|..:..|.|    .|:|
  Fly  1155 PKSFVTIAELERHTKAKHSKDKTLRCF--MDGCRKTF----AFKHHLIRHQKASHLS----TRYI 1209

  Fly   325 CEECGKCFARKAHLTRHKMVH-GSVEGRRYCCECCDRRFYTKENMVDHLLRKH 376
            |..|.|......||..|..|| |.:   .|.|..|||.:..:..:|.|.|..|
  Fly  1210 CPVCNKEEKSNVHLKNHMSVHKGEI---TYKCPKCDRSYLRRGRLVTHALIIH 1259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 14/56 (25%)
C2H2 Zn finger 289..314 CDD:275368 5/24 (21%)
zf-C2H2 323..345 CDD:278523 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 4/14 (29%)
C2H2 Zn finger 1124..1144 CDD:275368 7/19 (37%)
C2H2 Zn finger 1151..1172 CDD:275368 7/20 (35%)
C2H2 Zn finger 1180..1203 CDD:275368 5/28 (18%)
C2H2 Zn finger 1210..1230 CDD:275368 6/19 (32%)
C2H2 Zn finger 1238..1254 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.