DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG18011

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_610559.1 Gene:CG18011 / 36068 FlyBaseID:FBgn0033491 Length:985 Species:Drosophila melanogaster


Alignment Length:514 Identity:110/514 - (21%)
Similarity:169/514 - (32%) Gaps:202/514 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KSICECC---------YQLVQKFH-DFQR-----MCAESLRNFEKLLQDIDIGCHK--------L 126
            :|.||.|         :....:|| :..|     :|..:..|.::|.|.::.. |:        |
  Fly   427 RSYCEMCSLEFPSWKRFNFHSQFHLEKHRPRACFVCDYATTNIDELFQHLNYS-HEPVGTLFCDL 490

  Fly   127 EDHTWHDLDTPSESNES---TNPEAQSHAPCIA-----------------------------ATQ 159
            .|.|:.|.....|.|:|   .:....|.:.|:|                             ||:
  Fly   491 CDRTFRDPSVFMEHNKSHANVSSTTYSCSECMANFESRGRLNGHMRAMHGSVISCELCSREFATE 555

  Fly   160 EIVSFIWPQ---------VCLPLAVIL-SRITL------------GASLEEEV----YVIEDESA 198
            ...:....:         ||....::. ||.||            |:.::.|:    ||.|..|:
  Fly   556 ATYNIHMKKHLIIEKDVHVCSTCGLLSDSRETLLAHVNSVKTACFGSKIDVELLRDAYVCEYCSS 620

  Fly   199 KQDLGQEKLSISSKLLGARKRRGVRH--TLECRICHRGFYKPSLLEAHMQQHEGLRP-------- 253
               ..:||     ..|.|.:..||..  ...|:.|.:.|....|...|::.::.||.        
  Fly   621 ---YFKEK-----DCLQAHRDSGVHKDGVFLCQPCGKEFPHMKLYRHHLRNYQQLRSDSTHRRLE 677

  Fly   254 ----YTC--VHCAKSYARANLLESHLRQMHNNAD------------------------------- 281
                |.|  .:|.:||...|.|.:|.|:.|.:|.                               
  Fly   678 ICVYYMCDQENCTESYVNWNSLYTHKRRTHESASKQAEKSSKSAQEWVCQFCLKECRSKMSLSVH 742

  Fly   282 AARI----IYACPSCNKVYTANRSLKYHMRRTHERYHES-ESPDA-------------------- 321
            .||.    ...||.||..|.::.:|..|    |..:||. |.|:.                    
  Fly   743 VARSHNNDNVTCPLCNSSYKSHDALAKH----HAYWHEPIECPECFKIVKNRRNYDTHVNVVHSN 803

  Fly   322 --RHICEECGKCFARKAHLTRHKMVHGS--------------------VEGRRYC-----CECCD 359
              |:.|..|.|.|..|:.:..|:.:||.                    |.|:.|.     |..|.
  Fly   804 KKRYSCSVCQKGFYHKSEMEAHQKLHGQSYSCEQCSFTTRNKKSLSVHVLGQHYKRFAFECNVCK 868

  Fly   360 RRFYTKENMVDHLLRKHGNKNLLLRCRK-----CGRIFQNSVELNAHGRK-HKAMDVVQ 412
            :||...:.:..|:.|.||:|   ..||.     |||.|.||.:||.|.|| |..:.::|
  Fly   869 KRFGRSQGLKTHMQRAHGDK---YTCRDYFDGGCGRTFVNSSQLNVHVRKIHDGIILLQ 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 9/44 (20%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 20/93 (22%)
C2H2 Zn finger 289..314 CDD:275368 8/24 (33%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 13/25 (52%)
CG18011NP_610559.1 PRK14950 <98..>184 CDD:237864
C2H2 Zn finger 488..508 CDD:275368 6/19 (32%)
C2H2 Zn finger 518..538 CDD:275368 2/19 (11%)
C2H2 Zn finger 545..565 CDD:275368 2/19 (11%)
C2H2 Zn finger 575..596 CDD:275371 5/20 (25%)
SFP1 <682..747 CDD:227516 13/64 (20%)
C2H2 Zn finger 754..775 CDD:275368 8/24 (33%)
C2H2 Zn finger 780..801 CDD:275368 1/20 (5%)
C2H2 Zn finger 809..829 CDD:275368 6/19 (32%)
C2H2 Zn finger 864..885 CDD:275368 6/20 (30%)
C2H2 Zn finger 891..917 CDD:275368 13/25 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.