DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG1602

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster


Alignment Length:337 Identity:72/337 - (21%)
Similarity:113/337 - (33%) Gaps:113/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QDLASKYY---------GCTGE----DAVRDLPPQLV-LKSICECCYQLVQKFHDFQRMCAESLR 110
            |:|...||         |.|.|    :..|.:|.::. .:.:||.|:|:....|..|        
  Fly   325 QNLRQWYYKNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQ-------- 381

  Fly   111 NFEKLLQDIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAATQEIVSFIWPQVCLPLAV 175
                        .|..:.|...:|  |.:              |....:..|.     .| .||.
  Fly   382 ------------SHIFKAHNIGEL--PFK--------------CTLCDRSFVG-----RC-ELAN 412

  Fly   176 ILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSL 240
            .:.|:.:|                                        .|.:|..|.|.|...|.
  Fly   413 HIQRVHIG----------------------------------------KTHKCTHCERSFAVMSD 437

  Fly   241 LEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYH 305
            |:.|::.|.|.:||.|.||.|::...:.:..|:..:|....|    :.|..|.|.:.....|..|
  Fly   438 LQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRA----FKCTMCPKDFVKKVDLSDH 498

  Fly   306 MRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVD 370
            : :.|....:.       ||..|||.|.....|.||:.:|..|  :::.|:.||.||.....:..
  Fly   499 I-KGHLNIRDK-------ICSVCGKGFTSCHALIRHRQIHSEV--KKFVCKLCDSRFSQFVGLNT 553

  Fly   371 HLLRKHGNKNLL 382
            |:.|.|   |:|
  Fly   554 HMKRTH---NIL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 15/68 (22%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 13/56 (23%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510 8/30 (27%)
C2H2 Zn finger 367..388 CDD:275368 7/40 (18%)
C2H2 Zn finger 397..418 CDD:275368 6/26 (23%)
COG5048 <423..554 CDD:227381 40/144 (28%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..460 CDD:290200 10/22 (45%)
C2H2 Zn finger 453..470 CDD:275368 4/16 (25%)
C2H2 Zn finger 482..502 CDD:275368 5/20 (25%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..559 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.