DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and fezf-1

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_502594.2 Gene:fezf-1 / 3564888 WormBaseID:WBGene00012639 Length:218 Species:Caenorhabditis elegans


Alignment Length:182 Identity:50/182 - (27%)
Similarity:82/182 - (45%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIY 287
            |....|.||.:.|.....|..||..|.|.||:.|..|.|::.:|:.|..| :.:|.::..    :
 Worm    49 RKKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRH-KIIHTDSKP----H 108

  Fly   288 ACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRR 352
            .|.:|.|.:..:.:|     .||.|.|:...|   .:||.|||.|.:..:...|::.|  .:.::
 Worm   109 KCKTCGKCFNRSSTL-----NTHVRIHQGFKP---FVCEICGKGFHQNGNYKNHRLTH--EDTKK 163

  Fly   353 YCCECCDRRFYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRK 404
            :.|..|.|.|:...|:..|:.....:|.  ..|..|.:.|..:.:|..|.||
 Worm   164 FSCSICSRAFHQSYNLAFHMFTHEEHKP--FTCHVCSKGFCRNFDLKKHLRK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 13/56 (23%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 7/20 (35%)
fezf-1NP_502594.2 COG5048 <13..212 CDD:227381 48/179 (27%)
DUF3449 <50..>70 CDD:288759 5/19 (26%)
C2H2 Zn finger 54..74 CDD:275368 7/19 (37%)
zf-H2C2_2 66..91 CDD:290200 10/24 (42%)
C2H2 Zn finger 82..102 CDD:275368 6/20 (30%)
C2H2 Zn finger 110..130 CDD:275368 7/24 (29%)
C2H2 Zn finger 138..158 CDD:275368 7/19 (37%)
C2H2 Zn finger 166..186 CDD:275368 6/19 (32%)
C2H2 Zn finger 194..212 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.