DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG30431

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:442 Identity:97/442 - (21%)
Similarity:160/442 - (36%) Gaps:110/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MICRACLVLLGPQDACHNL-DSEQDLASKYYGCTGEDAVRDLPPQLVLKS-------ICECCYQL 94
            ::||.||:...|  ..|:| |:...||.:         ::.|.|.|.|:.       ||:.|.:.
  Fly    10 LVCRCCLLEQPP--LYHSLYDASSQLAVE---------LKALAPALRLEHGDNLTDVICDLCLRR 63

  Fly    95 VQKFHDFQRMCAES--------------------------LRNFEK------------------- 114
            :....||||.|..|                          |...|:                   
  Fly    64 LHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPV 128

  Fly   115 -----LLQDIDIGCHKLED--HTWHDLDTPSESN-ESTNPEAQSHAPCIAATQEIVSFIWPQVCL 171
                 |::.:|......:|  |:.||:.:..||: :|.:.....|.|   .|.|:.:...|    
  Fly   129 AHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQP---ETAELFAVEPP---- 186

  Fly   172 PLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLE---CRICHR 233
                     |...|.||..   .|.:.|..:.:.:....:.....||..|..|...   |..|.:
  Fly   187 ---------TPPESSEEPA---PDAAEKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEK 239

  Fly   234 GFYKPSLLEAHMQQHEGL--RPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVY 296
            .|.:...|:.||....|:  ..|.|..|.|::|..:.|..|::.:|:....    :.|..|::.:
  Fly   240 KFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERP----FGCQHCDRRF 300

  Fly   297 TANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRR 361
            .....|..|:|.     |..|:......|:.|.|.:..|:.|..|...|.....|.:.|:.|.:.
  Fly   301 ILRTQLLSHLRT-----HTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKA 360

  Fly   362 FYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAH-GRKHKAMDVVQ 412
            |:|:.::..|||...|.|.  ..|..|.:.:|:...||.| .|.|  .|:::
  Fly   361 FFTRGHLNSHLLVHTGEKP--FACEYCDKCYQSVGNLNNHMVRLH--ADIIE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 25/133 (19%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 12/56 (21%)
C2H2 Zn finger 289..314 CDD:275368 5/24 (21%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 7/20 (35%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 23/81 (28%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 5/24 (21%)
zf-C2H2_8 305..373 CDD:292531 19/72 (26%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 7/24 (29%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.