DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and ham

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_724130.4 Gene:ham / 35135 FlyBaseID:FBgn0045852 Length:1108 Species:Drosophila melanogaster


Alignment Length:179 Identity:52/179 - (29%)
Similarity:80/179 - (44%) Gaps:18/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LECRICHRGFYKPSLLEAHM--QQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYA 288
            :.|.:|.:.:....||:.|:  ..|.....:.|..||..:....||..|....|||...    |:
  Fly   339 IRCEVCDKVYPDLDLLDDHLIGAHHFKQDEFPCKQCALRFCHRPLLIKHEAISHNNIRK----YS 399

  Fly   289 CPSCNKVYTANRSLKYHMRRTHERYHESESPDAR-HICEECGKCFARKAHLTRHKMVHGSVEGRR 352
            |.:|:||:....:|:.|:|    .||..    || |.|.||||.|...:.|.:|:.:|.||  :.
  Fly   400 CENCSKVFCDPSNLQRHIR----AYHVG----ARCHPCPECGKTFGTSSGLKQHQHIHSSV--KP 454

  Fly   353 YCCECCDRRFYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAH 401
            :.||.|.:.:....|:..| .|.|....:.::|.||.:.|.....|..|
  Fly   455 FACEVCSKAYTQFSNLCRH-KRMHATCRMQIKCDKCNQSFSTLTSLTKH 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/21 (24%)
C2H2 Zn finger 256..313 CDD:275368 17/56 (30%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/17 (35%)
hamNP_724130.4 PR-SET_ZFPM 131..253 CDD:380978
C2H2 Zn finger 341..363 CDD:275368 5/21 (24%)
C2H2 Zn finger 371..392 CDD:275368 6/20 (30%)
SFP1 <391..479 CDD:227516 34/102 (33%)
C2H2 Zn finger 400..421 CDD:275368 7/24 (29%)
SUF4-like 403..>445 CDD:411020 18/49 (37%)
C2H2 Zn finger 403..421 CDD:411020 6/21 (29%)
C2H2 Zn finger 429..449 CDD:275368 8/19 (42%)
C2H2 Zn finger 457..477 CDD:275368 6/20 (30%)
C2H2 Zn finger 486..504 CDD:275368 6/17 (35%)
PTZ00121 <641..>728 CDD:173412
COG5048 935..>1028 CDD:227381
zf-C2H2 935..957 CDD:395048
C2H2 Zn finger 937..957 CDD:275368
zf-H2C2_2 949..973 CDD:404364
C2H2 Zn finger 965..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.