DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG4496

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:447 Identity:83/447 - (18%)
Similarity:129/447 - (28%) Gaps:191/447 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RNFEKLLQDIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAATQEIVSFIWPQVCLPLA 174
            |...:::.:|:     |.|.. ||.|:..:.:.|....|.|   |:...|.              
  Fly   151 RRVHRVVAEIE-----LSDSD-HDEDSEVDEDVSLPSNAVS---CVLNEQR-------------- 192

  Fly   175 VILSRITLGASLEEEVYVI-----EDESAKQDLGQEKLSISSKLLGAR---KRRGVRHTLECRIC 231
                  ..|:...:|:.:|     |||....::.:.|.|.|.:|:..|   .||| ||..||..|
  Fly   193 ------QDGSQNPQELVIIVPSDQEDEQKTDNVIKRKSSGSRRLVKRRPGANRRG-RHMYECPDC 250

  Fly   232 HRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQ--------------------- 275
            .:.......|..||..|.|.||:.|..|.:.:...:.|:.|.|:                     
  Fly   251 GKKVQSNYNLRRHMMIHTGERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGAPLEQD 315

  Fly   276 ----------------------------------------------------------------- 275
                                                                             
  Fly   316 STRCADCESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIP 380

  Fly   276 --------------------------------MHNNADAA-------RIIYACPSCNKVYTANRS 301
                                            :.|:.:.|       |..|.||.|::.:....:
  Fly   381 PIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHN 445

  Fly   302 LKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRF---- 362
            ||     .|...|..|.|.:   |.:|.|.|...:.|.:|.:.|  |..|.|.|..|..:|    
  Fly   446 LK-----RHYMIHTGEKPFS---CSKCRKPFRECSTLKKHMVTH--VRDRWYKCLRCPSKFRDYL 500

  Fly   363 -YT--KENMVDHLLRK---------HGNKNL--LLRCRKCGRIFQNSVELNAHGRKH 405
             |:  |.|..|.|..:         .|:.::  .|.|.:|.:.|.......||.:||
  Fly   501 EYSDHKNNHQDQLSSRKSSIYESDDDGDSSVEDCLECCECQQRFTELDAYTAHLKKH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 1/4 (25%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 15/181 (8%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 8/36 (22%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 6/21 (29%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
zf-H2C2_2 259..282 CDD:290200 9/22 (41%)
C2H2 Zn finger 275..295 CDD:275368 5/19 (26%)
zf-C2H2 431..453 CDD:278523 7/26 (27%)
C2H2 Zn finger 433..453 CDD:275368 6/24 (25%)
zf-H2C2_2 445..468 CDD:290200 9/30 (30%)
C2H2 Zn finger 461..481 CDD:275368 6/19 (32%)
C2H2 Zn finger 489..510 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.