DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG1529

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:436 Identity:107/436 - (24%)
Similarity:174/436 - (39%) Gaps:131/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ICRACLVLLGPQDACHNLDS----------EQDLASKYYGCTGEDAVRDLPPQLVLKSICECCYQ 93
            :||.||..|..:|. |..|.          :.|:..:.:|...|              ||..|:.
  Fly    11 LCRICLRHLRDRDT-HCPDPRLIAILQKLLDIDILKQPHGFPTE--------------ICNLCHN 60

  Fly    94 LVQKFHDFQRMCAESLRNFEKLL--QDIDIGCHKL----------EDHTWHDLDTPSESNESTNP 146
            .|..|.:.:::..||   .:||:  |.:||...::          |:|.    :...|..|....
  Fly    61 AVVYFDELRQVARES---SQKLIGWQPVDIAVDRVKEEPPDEGLKENHE----ENEHELEEEHEK 118

  Fly   147 EAQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISS 211
            :|......::..||                 .:..:....|:|.|..|.|:::|.|.|.      
  Fly   119 QADGQQVDLSKKQE-----------------DQKKILDDREDEEYPDEYENSQQQLSQG------ 160

  Fly   212 KLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQ-HEGL-RPYTCVHCAKSYARANLLESHLR 274
              .|:::|.|    |.|..|.:..||...||||::. |:|. :|:.|..|.||:.|...|.||:|
  Fly   161 --TGSKRRAG----LACDQCGKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMR 219

  Fly   275 QMHNNADAAR-----IIYACPSCNKVYTANRSLKYHMRR-----------------------THE 311
            ..|...:..:     :|  |..||:.|:...:|..|::|                       ||.
  Fly   220 NAHPQLEQLQQELRDLI--CELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHL 282

  Fly   312 RYHESESPD-ARHICEECGKCFARKAHLTRH-KMVHGSVEG-RRYCCECCDRRFYTKENMVDHLL 373
            |.|   :|. .|..||:|.:.|..|:.::|| ::||   || ||:.|..|:::|.|..:.|.| .
  Fly   283 RTH---NPTWERFKCEQCPQLFRHKSAISRHVRVVH---EGQRRFQCGHCEKKFGTHASQVRH-E 340

  Fly   374 RKHGNKN-----------LLLRCRK-CGRIFQNSVELNAHGRKHKA 407
            |.|....           ..:.|:| |  :.:.::||  |.|:|:|
  Fly   341 RLHTESTGSGEAAEEWPFACIHCQKPC--VSRQTLEL--HLRRHRA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 18/85 (21%)
C2H2 Zn finger 228..248 CDD:275368 8/20 (40%)
C2H2 Zn finger 256..313 CDD:275368 20/84 (24%)
C2H2 Zn finger 289..314 CDD:275368 10/47 (21%)
zf-C2H2 323..345 CDD:278523 7/22 (32%)
C2H2 Zn finger 325..345 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 7/20 (35%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 18/85 (21%)
C2H2 Zn finger 171..192 CDD:275368 8/20 (40%)
zf-C2H2_2 201..>257 CDD:289522 17/57 (30%)
C2H2 Zn finger 201..222 CDD:275368 9/20 (45%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 3/19 (16%)
zf-C2H2_8 268..349 CDD:292531 27/87 (31%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 360..380 CDD:275368 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.