DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG7101

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:370 Identity:78/370 - (21%)
Similarity:124/370 - (33%) Gaps:107/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KTMICRACLVLLGPQ-------DACHNLDSE---QDLASKYYGCTGEDAVRDLPPQLVLKSICEC 90
            :..:|..||.|.|.:       :..|| |.:   .....||...|                   .
  Fly    60 RLFVCPHCLTLFGEEARLERHRERKHN-DGQFLCLQCGKKYASAT-------------------F 104

  Fly    91 CYQLVQKFHDFQR-----MCAESLRNFEKLLQDIDIGCHKLEDHTWHDL-----DTPSESNESTN 145
            .|:.|..:|..|.     ||.::..:.:.....:::..|..|.|....|     |..|:.:|..:
  Fly   105 LYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRTLKSTASDADSQVDEMED 169

  Fly   146 PE-----AQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQE 205
            .|     .::..|.|....:: :|.||                                .||.:|
  Fly   170 LEMLEENIENILPSIDWDDDL-TFGWP--------------------------------TDLDKE 201

  Fly   206 KLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLE 270
            ...:::|          .....|..|..||.....|..|::|........|.:|.||:.....|.
  Fly   202 SCIVNAK----------PSVFVCPFCANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSREALR 256

  Fly   271 SHLRQMHNNADAARII---YACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCF 332
            |||:::|       |:   :.|..|...:.....||.|:...|..:..       |:|..|||.|
  Fly   257 SHLQRVH-------ILLRGHVCGICQADFATADHLKKHVNSLHLDHRP-------HLCPTCGKRF 307

  Fly   333 ARKAHLTRH-KMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKH 376
            .::.|||.| |...|...| .|.||.|.|.|:...::..|:..:|
  Fly   308 TQRCHLTDHIKTDRGHGHG-TYTCEFCVRPFFRAIDLERHVCEEH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 17/90 (19%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 16/59 (27%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 11/22 (50%)
C2H2 Zn finger 325..345 CDD:275368 10/20 (50%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 15/52 (29%)
C2H2 Zn finger 242..263 CDD:275368 8/20 (40%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 9/18 (50%)
C2H2 Zn finger 330..347 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.