DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG9609

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:227 Identity:59/227 - (25%)
Similarity:96/227 - (42%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 RKRRGVRHTL-----ECRI--CHRGFYKPSLLEAHMQQHEGLRPYTCVH--CAKSYARANLLESH 272
            ::|:|.|:::     .|.:  |...|.:...|:.|...|.|::.:.|.:  |.|:|:....|:.|
  Fly    21 KQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTGIKKHACSYEGCDKTYSIVTHLKRH 85

  Fly   273 LRQMHNNADAA---RIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFAR 334
            ||..|...::|   .:..|...|:|::.:..::..|||.||      |||.. :.|.:|...|::
  Fly    86 LRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMRETH------ESPKV-YPCSQCSAKFSQ 143

  Fly   335 KAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDH--------------------LLRKHGNK 379
            |..|.||::...::| ..|.|..|.|.||.:.....|                    |..||...
  Fly   144 KLKLKRHEIREHTLE-YPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTLYTKHCRD 207

  Fly   380 NL----LLRCRKCGRIFQNSVELNAHGR-KHK 406
            :|    ..:|.:|...|....||..|.. |||
  Fly   208 SLHGKNRHKCDRCDSAFDKPSELKRHLEVKHK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/21 (24%)
C2H2 Zn finger 256..313 CDD:275368 18/61 (30%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 7/40 (18%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 4/18 (22%)
zf-C2H2_8 67..150 CDD:292531 26/89 (29%)
C2H2 Zn finger 67..90 CDD:275368 8/22 (36%)
C2H2 Zn finger 106..126 CDD:275368 5/19 (26%)
C2H2 Zn finger 134..155 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..210 CDD:275368 3/21 (14%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368
C2H2 Zn finger 283..302 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.