DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG11695

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:413 Identity:103/413 - (24%)
Similarity:159/413 - (38%) Gaps:85/413 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MICRACLVLLGPQDACHNLD-SEQDLASKYYGCTGEDAVRD--------------LPPQLVLKSI 87
            ||||.||     .||.|::. .:||       .:|:..|..              ||...|.||:
  Fly     1 MICRLCL-----DDAEHSVPIFDQD-------DSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSL 53

  Fly    88 CECCYQLVQKFHDFQRMCAESLRNFEKLLQ----------------------DIDIGCHKLEDHT 130
            |..|:   |:..||::.||..::....|.|                      :||:.....::..
  Fly    54 CTQCW---QQLADFEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDVSPAAADNEE 115

  Fly   131 WHDLDTPSESNESTNPEAQSHAPCIAAT----QEIVSFIWPQVCLPLAVILSRI-TLGASLEEEV 190
            .:::|..:.||        |.:..|..|    ..:.|.|..::.||.||...:. .:.|....:.
  Fly   116 CNEIDGDASSN--------SRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKT 172

  Fly   191 Y---VIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLE--AHMQQHEG 250
            :   ..|||.|:.:...|..|.:|:.:.:  ...:...|||.||......|:..|  .|.:.|..
  Fly   173 HKAEADEDEDAEGEGDPESRSSNSREMDS--YIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQ 235

  Fly   251 LRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHE 315
            ...|. |.|.:.|.:..|...|| .|||:.:    .:.|..|:|...:..|...||.|.|     
  Fly   236 SLGYV-VCCQRRYKKRALYVDHL-HMHNDPN----YFRCKICSKQLVSRISYDVHMLRFH----- 289

  Fly   316 SESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKHGNKN 380
            ....|....|::|.|.|:::..||.|..||  .:.|...|:.|||.|.|..::..|:.|.|....
  Fly   290 PNKDDLSFACDQCSKRFSKQFLLTIHSRVH--QQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAF 352

  Fly   381 LLLRCRKCGRIFQNSVELNAHGR 403
            :...|..||..|:....|..|.|
  Fly   353 VPFICDSCGAKFKTKQNLLVHKR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 24/90 (27%)
C2H2 Zn finger 228..248 CDD:275368 6/21 (29%)
C2H2 Zn finger 256..313 CDD:275368 17/56 (30%)
C2H2 Zn finger 289..314 CDD:275368 8/24 (33%)
zf-C2H2 323..345 CDD:278523 7/21 (33%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 25/93 (27%)
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 7/19 (37%)
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 420..440 CDD:275368
C2H2 Zn finger 448..468 CDD:275368
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.