DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG3032

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:426 Identity:97/426 - (22%)
Similarity:161/426 - (37%) Gaps:129/426 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ICRACLVLLGPQDACHNLDSE-----QDLASKYYGCTGEDAV-RDLPPQLVLKSICECCYQLVQK 97
            :|..||:.|..:.....|.|:     |:|.........:|.. :|...|.:...:|..|...||.
  Fly    13 LCCTCLLQLEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQN 77

  Fly    98 FHDFQRMCAESLRNFEKLLQ--------DIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPC 154
            |..|:|...|..:...::|:        ::.....:.:..:.|.|:.|   ..:.:|:.      
  Fly    78 FEKFRRKADECRKQLLEMLKKDPREPTFEVVYDGREEDQESLHGLEPP---EPAPDPDP------ 133

  Fly   155 IAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKR 219
                                                  |::.:.|.|....|           ..
  Fly   134 --------------------------------------IDEPAIKSDKSPRK-----------SF 149

  Fly   220 RGVRHTLECRICHRGFYKPSLLEAHMQQ-HEG-LRPYTCVHCAKSYARANLLESHLRQMHNNADA 282
            ||.|:||:|.:|.|.|.....|.||::: ||| .||:.|..|.|:|:....|.:|:|::|...:.
  Fly   150 RGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKER 214

  Fly   283 ARIIYAC--PSCNKVYTANRSLKYHMRRTHERYHESESP---DA--RHICEECGKCFARKAHLTR 340
            .   :.|  |.|.::||:..:::.|.|..|       ||   ||  :.|||:||..|.:.|:|..
  Fly   215 R---HPCDQPGCERIYTSRIAMQKHKRLKH-------SPRDRDALKKFICEQCGASFNQSANLKY 269

  Fly   341 H-KMVHGSVE---------GRRYCCECCDRRFYTKENMVDHLLRKH-----------------GN 378
            | |..|.:.:         |.|:.|:.|.:.|:::..:..|.|::|                 ..
  Fly   270 HLKTKHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAK 334

  Fly   379 KNLLLR-----------CRKCGRIFQNSVELNAHGR 403
            |.:||:           |..|||.|....||.||.|
  Fly   335 KFMLLQHMLMHSNDKLPCEHCGRRFARRFELEAHVR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 19/81 (23%)
C2H2 Zn finger 228..248 CDD:275368 7/20 (35%)
C2H2 Zn finger 256..313 CDD:275368 16/58 (28%)
C2H2 Zn finger 289..314 CDD:275368 8/26 (31%)
zf-C2H2 323..345 CDD:278523 10/22 (45%)
C2H2 Zn finger 325..345 CDD:275368 9/20 (45%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 10/19 (53%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 19/81 (23%)
C2H2 Zn finger 158..179 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 218..239 CDD:275368 6/20 (30%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 325..345 CDD:275368 3/19 (16%)
C2H2 Zn finger 352..373 CDD:275368 10/19 (53%)
C2H2 Zn finger 381..401 CDD:275368
C2H2 Zn finger 409..429 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.