DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG12219

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:602 Identity:96/602 - (15%)
Similarity:136/602 - (22%) Gaps:343/602 - (56%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MICRACLVLLGPQDA-----------CHNLDSEQD------------LASKYYGCTGEDAVRDLP 79
            ||||.||..|..|.|           ....|.|.|            ::...|.|...|      
  Fly     1 MICRLCLNALDEQSAVLLFDGAGGASAPAPDDEDDGKAMPESYLVQLISIHLYLCLSRD------ 59

  Fly    80 PQLVLKSIC-ECCYQLVQKFHDFQRMCAESLRNFEKLLQDIDIGCHKLEDHTWHDLDTPSESNES 143
             ..:...|| |||.|| :.||:|.::.  .|:......|.:.|.|    |..|      ||....
  Fly    60 -DAISTCICTECCSQL-ESFHNFWKLV--ELKQTTLCSQFLAIDC----DVNW------SEDGSE 110

  Fly   144 TNPEAQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLS 208
            |..:||                 ||:.|..|             ||..|:...:|.:        
  Fly   111 TQLDAQ-----------------PQLLLEPA-------------EEPKVVTPTTANK-------- 137

  Fly   209 ISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHL 273
                             ..|..|.:.|.....||.|:..|.|.||..|.:|..::...:.:.:|:
  Fly   138 -----------------FPCMFCEKSFKMRRYLEEHIATHTGDRPIACPYCEMAFRCRSNMYTHV 185

  Fly   274 RQMH--------NNADAAR--------------IIYACP------------------SCNKVYTA 298
            :..|        ...|||:              ::...|                  :.|...||
  Fly   186 KSKHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPALASAPASSASPGNTVNPAATA 250

  Fly   299 -------------------------------------------------------NRSLKYHMRR 308
                                                                   |||.:   |:
  Fly   251 TPASSATPTTNLAAAPLPSPPTVQQLPLSVIKSQPSEAMNLTITKTPPSGSRGSRNRSSR---RK 312

  Fly   309 TH--------------------ERYHESE-------------------------SPDA------- 321
            ||                    :|..|:|                         .||:       
  Fly   313 THSPKKVQHTEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASLTGNPPGQPDSLQQRLCA 377

  Fly   322 ----------------------------------------------------------------- 321
                                                                             
  Fly   378 SLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNHPPSETDKRPAAPLQAV 442

  Fly   322 ---------------------------RHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCD 359
                                       ::.|:.|||.|..|.:|..|...|..|  :.:.|..|.
  Fly   443 IHAAPVSIICPNCGELPGQNHRCLSKPKYACDVCGKSFKMKRYLEEHFATHTGV--KLHTCAFCP 505

  Fly   360 RRFYTKENMVDHLLRKH 376
            ..|.:|.||..|..|||
  Fly   506 TEFRSKSNMYHHTKRKH 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 25/99 (25%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 17/171 (10%)
C2H2 Zn finger 289..314 CDD:275368 11/117 (9%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 385..405 CDD:275368
CG12219NP_572312.1 zf-AD 2..94 CDD:285071 25/101 (25%)
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG4049 149..204 CDD:226535 13/54 (24%)
C2H2 Zn finger 168..186 CDD:275368 3/17 (18%)
C2H2 Zn finger 473..493 CDD:275370 8/19 (42%)
C2H2 Zn finger 501..522 CDD:275370 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.