DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and CG11398

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:285 Identity:68/285 - (23%)
Similarity:101/285 - (35%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 HTWHD----LDTPSESNESTNPEAQSH---APCIAATQEIVSFIWPQVC--LPLAVILSRITLGA 184
            ||:.|    |:|.....|..|..:|..   :|         ||    ||  .| |:.|:|..|.|
  Fly    17 HTYEDEELSLNTEELQFEELNERSQHQQGGSP---------SF----VCRRCP-ALFLTREELAA 67

  Fly   185 SLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHE 249
            ......|                      .|.::.....|.  |..|.|.|.|.:.|..||..|.
  Fly    68 HRPTHRY----------------------QGGQQTPASEHA--CDACGRVFQKHNALVDHMNAHN 108

  Fly   250 GLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYAC--PSCNKVYTANRSLKYHMRRTHER 312
            .:|.|.|..|...:.:.:..|.||:.:|...    .:::|  |.|.|.:...|....|::..|:.
  Fly   109 DVRNYPCPECPARFVQRSNRECHLKNVHRKV----YLHSCPEPGCKKRFQQRRECDQHVKTVHQN 169

  Fly   313 YHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKHG 377
                   :...:|:.|...|:...:..:|...|||  .:.|.|..|.:.|...||...||.....
  Fly   170 -------ERNLVCDTCSARFSHPVNYRKHLASHGS--AKSYGCPICGKLFGRPENRDVHLFVHSI 225

  Fly   378 NKNLLLRCRKCGRIFQNSVELNAHG 402
            .|..:  |..||..:....:|..||
  Fly   226 CKAYI--CSVCGADYMRRNQLIRHG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
C2H2 Zn finger 256..313 CDD:275368 13/58 (22%)
C2H2 Zn finger 289..314 CDD:275368 7/26 (27%)
zf-C2H2 323..345 CDD:278523 4/21 (19%)
C2H2 Zn finger 325..345 CDD:275368 4/19 (21%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 6/18 (33%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/20 (35%)
C2H2 Zn finger 87..107 CDD:275368 8/19 (42%)
C2H2 Zn finger 115..136 CDD:275368 5/20 (25%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.