Sequence 1: | NP_001261767.1 | Gene: | CG10654 / 39428 | FlyBaseID: | FBgn0036294 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005258770.1 | Gene: | ZNF324 / 25799 | HGNCID: | 14096 | Length: | 558 | Species: | Homo sapiens |
Alignment Length: | 226 | Identity: | 71/226 - (31%) |
---|---|---|---|
Similarity: | 102/226 - (45%) | Gaps: | 32/226 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 182 LGASLEEEVYVI--EDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAH 244
Fly 245 MQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRT 309
Fly 310 HERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLR 374
Fly 375 KHGNKNLLLRCRKCGRIFQNSVELNAHGRKH 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10654 | NP_001261767.1 | zf-AD | 39..115 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 256..313 | CDD:275368 | 17/56 (30%) | ||
C2H2 Zn finger | 289..314 | CDD:275368 | 8/24 (33%) | ||
zf-C2H2 | 323..345 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 355..376 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 7/19 (37%) | ||
ZNF324 | XP_005258770.1 | KRAB | 6..66 | CDD:214630 | |
KRAB | 6..45 | CDD:279668 | |||
C2H2 Zn finger | 264..284 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <268..468 | CDD:227381 | 58/174 (33%) | ||
zf-H2C2_2 | 276..301 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 8/24 (33%) | ||
zf-H2C2_2 | 304..329 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 320..340 | CDD:275368 | 8/24 (33%) | ||
zf-H2C2_2 | 332..357 | CDD:290200 | 12/32 (38%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 374..396 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 376..396 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 388..413 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 404..424 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 416..441 | CDD:290200 | 4/9 (44%) | ||
C2H2 Zn finger | 432..452 | CDD:275368 | |||
COG5048 | 437..>524 | CDD:227381 | |||
zf-H2C2_2 | 444..468 | CDD:290200 | |||
C2H2 Zn finger | 460..480 | CDD:275368 | |||
zf-H2C2_2 | 473..495 | CDD:290200 | |||
C2H2 Zn finger | 488..508 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |