DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and scrt-1

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 / 183848 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans


Alignment Length:209 Identity:40/209 - (19%)
Similarity:72/209 - (34%) Gaps:87/209 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 PSESNESTNPEAQSH--APCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAK 199
            |:.|:..:.|....|  :|.::.:..:.|:..|                              :.
 Worm    45 PASSSSPSLPSFSLHSDSPSLSPSTTVTSYSTP------------------------------SS 79

  Fly   200 QDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYA 264
            .|..|.|.:..|.:            .:|::|.:.|.:..||:.|::.|.|.:|:.|..|:|.:|
 Worm    80 PDGKQLKFATCSPV------------CQCKVCGKRFSRQWLLQGHLRTHTGEKPFQCEICSKRFA 132

  Fly   265 -RANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEEC 328
             ::||                                       |.|.:.|....|   |.|..|
 Worm   133 DKSNL---------------------------------------RAHIQTHSGTKP---HKCPRC 155

  Fly   329 GKCFARKAHLTRHK 342
            ||.||.|::|::|:
 Worm   156 GKSFALKSYLSKHE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 8/57 (14%)
C2H2 Zn finger 289..314 CDD:275368 2/24 (8%)
zf-C2H2 323..345 CDD:278523 10/20 (50%)
C2H2 Zn finger 325..345 CDD:275368 9/18 (50%)
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 6/21 (29%)
C2H2 Zn finger 96..116 CDD:275368 6/19 (32%)
zf-H2C2_2 109..132 CDD:290200 8/22 (36%)
C2H2 Zn finger 124..144 CDD:275368 8/58 (14%)
zf-H2C2_2 136..160 CDD:290200 11/65 (17%)
C2H2 Zn finger 152..168 CDD:275368 8/15 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000984
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.