Sequence 1: | NP_001261767.1 | Gene: | CG10654 / 39428 | FlyBaseID: | FBgn0036294 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491001.2 | Gene: | scrt-1 / 183848 | WormBaseID: | WBGene00016948 | Length: | 178 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 40/209 - (19%) |
---|---|---|---|
Similarity: | 72/209 - (34%) | Gaps: | 87/209 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 PSESNESTNPEAQSH--APCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAK 199
Fly 200 QDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYA 264
Fly 265 -RANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEEC 328
Fly 329 GKCFARKAHLTRHK 342 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10654 | NP_001261767.1 | zf-AD | 39..115 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 256..313 | CDD:275368 | 8/57 (14%) | ||
C2H2 Zn finger | 289..314 | CDD:275368 | 2/24 (8%) | ||
zf-C2H2 | 323..345 | CDD:278523 | 10/20 (50%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 9/18 (50%) | ||
C2H2 Zn finger | 355..376 | CDD:275368 | |||
C2H2 Zn finger | 385..405 | CDD:275368 | |||
scrt-1 | NP_491001.2 | zf-C2H2 | 94..116 | CDD:278523 | 6/21 (29%) |
C2H2 Zn finger | 96..116 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 109..132 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 124..144 | CDD:275368 | 8/58 (14%) | ||
zf-H2C2_2 | 136..160 | CDD:290200 | 11/65 (17%) | ||
C2H2 Zn finger | 152..168 | CDD:275368 | 8/15 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000984 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |