DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10654 and pat-9

DIOPT Version :9

Sequence 1:	NP_001261767.1	Gene:	CG10654 / 39428	FlyBaseID:	FBgn0036294	Length:	412	Species:	Drosophila melanogaster
Sequence 2:	NP_510680.2	Gene:	pat-9 / 181714	WormBaseID:	WBGene00003933	Length:	470	Species:	Caenorhabditis elegans

Alignment Length:	115	Identity:	30/115 - (26%)
Similarity:	53/115 - (46%)	Gaps:	10/115 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   204 QEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANL 268
            |.|.:.:.:.|.|.::|    ...|.:|...|.....||.|...|.|.:|:.|..|...:.|.:.
Worm    66 QPKTNANGRALAADRKR----PYPCNLCSSKFGSKMELEEHQNSHTGQKPFECDTCNARFNRRST 126

  Fly   269 LESHLRQMHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESES 318
            |.:| :::|::|..    :.|..|...:....|||.| :..|:|.:|:.:
Worm   127 LWNH-KRIHSDAKP----FVCTVCQMTFKWKNSLKCH-KDMHQRKNETSA 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10654	NP_001261767.1	zf-AD	39..115	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	6/19 (32%)
		C2H2 Zn finger	256..313	CDD:275368	14/56 (25%)
		C2H2 Zn finger	289..314	CDD:275368	8/24 (33%)
		zf-C2H2	323..345	CDD:278523
		C2H2 Zn finger	325..345	CDD:275368
		C2H2 Zn finger	355..376	CDD:275368
		C2H2 Zn finger	385..405	CDD:275368
pat-9	NP_510680.2	C2H2 Zn finger	86..106	CDD:275368	6/19 (32%)
		zf-H2C2_2	98..123	CDD:290200	8/24 (33%)
		C2H2 Zn finger	114..134	CDD:275368	5/20 (25%)
		C2H2 Zn finger	142..162	CDD:275368	6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910