DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10654 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:305 Identity:71/305 - (23%)
Similarity:108/305 - (35%) Gaps:91/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RMCAESLRNFEKLLQDIDIGCHKLEDH-TWHDLDTPSESNESTNPEAQSHAPCIAATQEIVSFIW 166
            |.|:.:..:.::|.:      |:.|:| |....|...:..|..:.|                   
 Worm     8 RDCSGAFHSLDELQR------HEREEHETVEQGDQEEDRMEDDSDE------------------- 47

  Fly   167 PQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRIC 231
                  ||:|..:             |||.....|....:||::......:...|.:...||..|
 Worm    48 ------LAMIKIK-------------IEDSDFLSDTDSSQLSMNPTTPSEKSSSGEKGRYECEDC 93

  Fly   232 HRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVY 296
            |..|.....|..||:.|.|.:|::|..|.|.:....||:.|                        
 Worm    94 HEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKH------------------------ 134

  Fly   297 TANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRR 361
                    .|..|.||         .|:|..|.|.|.:|.|||:|.|:|..  ||.:.|..|.:.
 Worm   135 --------WMWHTGER---------SHVCPHCNKAFFQKGHLTQHLMIHSG--GRPHECPQCHKT 180

  Fly   362 FYTKENMVDHLLRKHGNKNLLLRCRKCGRIFQNSVELNAHGRKHK 406
            |..|.::..| ::.|..:.  ..|::|||.|...|.|:.|..|.|
 Worm   181 FIFKFDLNRH-MKIHQERG--FSCQQCGRSFLKQVMLDEHHLKCK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 2/11 (18%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 9/56 (16%)
C2H2 Zn finger 289..314 CDD:275368 4/24 (17%)
zf-C2H2 323..345 CDD:278523 11/21 (52%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 7/19 (37%)
zf-H2C2_2 102..127 CDD:290200 9/24 (38%)
C2H2 Zn finger 118..138 CDD:275368 7/51 (14%)
C2H2 Zn finger 146..166 CDD:275368 10/19 (53%)
zf-H2C2_2 158..181 CDD:290200 10/24 (42%)
zf-C2H2 172..194 CDD:278523 5/22 (23%)
C2H2 Zn finger 174..194 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.