DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10681 and AT3G29130

DIOPT Version :9

Sequence 1:NP_001261766.1 Gene:CG10681 / 39425 FlyBaseID:FBgn0036291 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001189998.1 Gene:AT3G29130 / 822561 AraportID:AT3G29130 Length:168 Species:Arabidopsis thaliana


Alignment Length:96 Identity:27/96 - (28%)
Similarity:50/96 - (52%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SAAEAFIQSLAGMVNQGDVETMIRAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCL 92
            :|::........:|...|:.::...|..:|.|.:.:|.:|.:.|..:::.....|.:|.|..:.|
plant    56 AASQEVSNEFKTLVKVEDLNSLRHLQHLILGRLQDSNAVLSHYNEFAENCFSDVSLEFARSTRLL 120

  Fly    93 SEMKKDLDYIFRKIRIIKQKLQSQFPAIYAE 123
            ..||.||||||.|:|.||.|:.:.:|..:.:
plant   121 KSMKADLDYIFLKLRSIKSKILATYPDAFPD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10681NP_001261766.1 KxDL 36..114 CDD:287243 25/77 (32%)
AT3G29130NP_001189998.1 KxDL 64..141 CDD:287243 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4298
eggNOG 1 0.900 - - E1_KOG3443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612645at2759
OrthoFinder 1 1.000 - - FOG0006436
OrthoInspector 1 1.000 - - oto2907
orthoMCL 1 0.900 - - OOG6_105852
Panther 1 1.100 - - LDO PTHR13511
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4698
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.