DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10681 and KXD1

DIOPT Version :9

Sequence 1:NP_001261766.1 Gene:CG10681 / 39425 FlyBaseID:FBgn0036291 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001165419.1 Gene:KXD1 / 79036 HGNCID:28420 Length:176 Species:Homo sapiens


Alignment Length:171 Identity:70/171 - (40%)
Similarity:93/171 - (54%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NSAAEAFIQSLAGMVNQGDVETMIRAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKC 91
            :||:..|...:..|||..||..:|.|||.||.|||||||||||.|.||.:||:..||.|..|.:.
Human     5 DSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRT 69

  Fly    92 LSEMKKDLDYIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDD----------TEAQAKKT 146
            |.|||:|||.|||:||.:|.||..|.|..::.: |:.|.|.||.||.          |..|:..:
Human    70 LVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHI-PEASFLEEEDEDPIPPSTTTTIATSEQSTGS 133

  Fly   147 AETPAPAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENE 187
            .:| :|....|.||  .....:.:||......||..:.::|
Human   134 CDT-SPDTVSPSLS--PGFEDLSHVQPGSPAINGRSQTDDE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10681NP_001261766.1 KxDL 36..114 CDD:287243 45/77 (58%)
KXD1NP_001165419.1 KxDL 14..93 CDD:287243 46/78 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..176 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148262
Domainoid 1 1.000 92 1.000 Domainoid score I7626
eggNOG 1 0.900 - - E1_KOG3443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4921
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612645at2759
OrthoFinder 1 1.000 - - FOG0006436
OrthoInspector 1 1.000 - - oto90884
orthoMCL 1 0.900 - - OOG6_105852
Panther 1 1.100 - - LDO PTHR13511
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4626
SonicParanoid 1 1.000 - - X4698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.