DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10681 and Kxd1

DIOPT Version :9

Sequence 1:NP_001261766.1 Gene:CG10681 / 39425 FlyBaseID:FBgn0036291 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_006252984.1 Gene:Kxd1 / 498606 RGDID:1562866 Length:221 Species:Rattus norvegicus


Alignment Length:189 Identity:71/189 - (37%)
Similarity:96/189 - (50%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VHQSEDATPDLESFTGFGNSAAEAFIQSLAGMVNQGDVETMIRAQKQMLQRFEKTNEMLLNCNAL 73
            |.:.|..|||         ||:..|......|||..||..:|.|||.||.|||||||||||.|.|
  Rat    40 VKEKEMDTPD---------SASRVFCGRFLSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNL 95

  Fly    74 SQSRLKSASEDFKRHVKCLSEMKKDLDYIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDD 138
            |..||:..||.|..|.:.|.:||:|||.|||:||.:|.||..|.|..::.: |:.|.|.:|.||.
  Rat    96 SSVRLQQMSERFMHHTRTLVDMKRDLDSIFRRIRTLKGKLARQHPEAFSHI-PEGSLLEDEDEDP 159

  Fly   139 ----------TEAQAKKTAETPAPAAAKPVLSTKKSAATIEYVQMEEAVDNGTVEIENE 187
                      |..|:..:.:| :|..|.|  |.......:.:::......||..:.::|
  Rat   160 VPPSITTTIATSEQSTGSCDT-SPDTASP--SFSPGFEDLSHIRPGSPAINGHSQTDDE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10681NP_001261766.1 KxDL 36..114 CDD:287243 44/77 (57%)
Kxd1XP_006252984.1 KxDL 58..137 CDD:287243 45/78 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342141
Domainoid 1 1.000 90 1.000 Domainoid score I7636
eggNOG 1 0.900 - - E1_KOG3443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612645at2759
OrthoFinder 1 1.000 - - FOG0006436
OrthoInspector 1 1.000 - - oto97978
orthoMCL 1 0.900 - - OOG6_105852
Panther 1 1.100 - - LDO PTHR13511
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4698
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.