DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10681 and kxd1

DIOPT Version :9

Sequence 1:NP_001261766.1 Gene:CG10681 / 39425 FlyBaseID:FBgn0036291 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001003469.1 Gene:kxd1 / 445075 ZFINID:ZDB-GENE-040801-207 Length:182 Species:Danio rerio


Alignment Length:183 Identity:69/183 - (37%)
Similarity:95/183 - (51%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SAAEAFIQSLAGMVNQGDVETMIRAQKQMLQRFEKTNEMLLNCNALSQSRLKSASEDFKRHVKCL 92
            :|:..|...:..|||..||..:|:||:.||.|||||||||:|.|.||..||:..:|.|..|.:.|
Zfish     4 TASGIFCNRMLSMVNSEDVNAIIQAQRHMLDRFEKTNEMLINFNGLSNVRLQQMNEHFLMHTRTL 68

  Fly    93 SEMKKDLDYIFRKIRIIKQKLQSQFPAIYAEVQPQRSSLAEEAEDDTEAQAKKTAETPAPAAAKP 157
            .|||||||.|||:||.:|.|:..|:|..::.|  ..||..|:.:|:.:         |.||:...
Zfish    69 IEMKKDLDSIFRRIRALKGKVAKQYPEAFSNV--SESSNLEDDDDEFD---------PIPASVAT 122

  Fly   158 VLSTKKSAATIEYVQMEEAVDNGTVEIENELIKRVCSVETANPNDSSDCTSED 210
            :.:|    ||.|  |..|:.|.              |.:..:|..|  |.|||
Zfish   123 ITTT----ATSE--QSTESCDT--------------SPDVISPTIS--CCSED 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10681NP_001261766.1 KxDL 36..114 CDD:287243 43/77 (56%)
kxd1NP_001003469.1 KxDL 12..91 CDD:287243 43/78 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..182 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582179
Domainoid 1 1.000 92 1.000 Domainoid score I7630
eggNOG 1 0.900 - - E1_KOG3443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4951
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612645at2759
OrthoFinder 1 1.000 - - FOG0006436
OrthoInspector 1 1.000 - - oto38977
orthoMCL 1 0.900 - - OOG6_105852
Panther 1 1.100 - - LDO PTHR13511
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4626
SonicParanoid 1 1.000 - - X4698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.