DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10681 and kxd-1

DIOPT Version :9

Sequence 1:NP_001261766.1 Gene:CG10681 / 39425 FlyBaseID:FBgn0036291 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_504831.1 Gene:kxd-1 / 182578 WormBaseID:WBGene00015742 Length:140 Species:Caenorhabditis elegans


Alignment Length:139 Identity:53/139 - (38%)
Similarity:79/139 - (56%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HQSEDATPDLESFTGFGNSAAEAF--------IQSLAGMVNQGDVETMIRAQKQMLQRFEKTNEM 66
            ||.::..|....|....| |..:|        |.||...:::..::::|..|:|.|:||||||||
 Worm     6 HQQQERLPGNPFFPSRSN-AGSSFDMPETPHLIDSLTSQIDEFTIQSIIDTQRQSLKRFEKTNEM 69

  Fly    67 LLNCNALSQSRLKSASEDFKRHVKCLSEMKKDLDYIFRKIRIIKQKLQSQFPAIYAEVQ----PQ 127
            |:||..|...|::.|..|...|.:.:.:||.||::||:|||:.|..|.|::|.:||||.    |:
 Worm    70 LMNCAQLGDRRIEKAKRDSVGHKETILQMKTDLEFIFKKIRMFKTVLSSKYPEVYAEVSAELTPK 134

  Fly   128 RSSLAEEAE 136
            ||   ||.|
 Worm   135 RS---EEDE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10681NP_001261766.1 KxDL 36..114 CDD:287243 32/77 (42%)
kxd-1NP_504831.1 KxDL 39..117 CDD:370912 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160117
Domainoid 1 1.000 81 1.000 Domainoid score I5480
eggNOG 1 0.900 - - E1_KOG3443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3670
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612645at2759
OrthoFinder 1 1.000 - - FOG0006436
OrthoInspector 1 1.000 - - oto17906
orthoMCL 1 0.900 - - OOG6_105852
Panther 1 1.100 - - LDO PTHR13511
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4626
SonicParanoid 1 1.000 - - X4698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.