DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AAD14

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:63/326 - (19%)
Similarity:115/326 - (35%) Gaps:106/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVGYRHIDTAYFYQN-EAEVGKAIRDKIAEGVVK---REDIFLVTKLWNIFHDPE----RVEGIC 95
            :.|...||||..||| |:|:.      |.|.:..   |:.|.:.||....:...|    :....|
Yeast    64 EAGGNCIDTANSYQNEESEIW------IGEWMASRKLRDQIVIATKFTGDYKKYEVGGGKSANYC 122

  Fly    96 -----------RKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAM 149
                       |..|.....|:||:..:|.   :.|                :|.::  :...::
Yeast   123 GNHKRSLHVSVRDSLRKLQTDWIDILYIHW---WDY----------------MSSIE--EVMDSL 166

  Fly   150 EKLVKLGLVRSIGVSN--------------------FNSEQ----------------LAR----V 174
            ..||:.|.|..:|||:                    |:..|                :||    .
Yeast   167 HILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGKWNVLNRDFERDIIPMARHFGMA 231

  Fly   175 LANCEIKPVTNQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKK 239
            ||..::.. ..:.:...|:.::      |||...|.  |.:|.|:.  .:.:...|..:..||::
Yeast   232 LAPWDVMG-GGRFQSKKAMEER------KKNGEGLR--TFVGGPEQ--TELEVKISEALTKIAEE 285

  Fly   240 YG-KTTPQIVLRYL--VGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLN 301
            :| ::...|.:.|:  ....|.|:........:.:|.:....:||.|::..|      |.:||.:
Yeast   286 HGTESVTAIAIAYVRSKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYL------ESIVPFD 344

  Fly   302 L 302
            :
Yeast   345 V 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 63/324 (19%)
Tas 5..297 CDD:223739 61/319 (19%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 60/317 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.