DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AAD10

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012689.1 Gene:AAD10 / 853620 SGDID:S000003916 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:70 Identity:14/70 - (20%)
Similarity:32/70 - (45%) Gaps:9/70 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 IAKKYG-KTTPQIVLRYLVGLG--VIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERV 297
            :|:::| ::...|.:.|:....  |.|:........:.:|.:....:||.|::..|      |.:
Yeast   194 VAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKIEHLKQNIEALSIKLTPEQIKYL------ESI 252

  Fly   298 VPLNL 302
            ||.::
Yeast   253 VPFDV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 14/68 (21%)
Tas 5..297 CDD:223739 12/63 (19%)
AAD10NP_012689.1 AKR_SF <1..250 CDD:412396 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.