powered by:
Protein Alignment CG10638 and AAD10
DIOPT Version :9
Sequence 1: | NP_001287050.1 |
Gene: | CG10638 / 39424 |
FlyBaseID: | FBgn0036290 |
Length: | 317 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012689.1 |
Gene: | AAD10 / 853620 |
SGDID: | S000003916 |
Length: | 288 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 32/70 - (45%) |
Gaps: | 9/70 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 IAKKYG-KTTPQIVLRYLVGLG--VIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERV 297
:|:::| ::...|.:.|:.... |.|:........:.:|.:....:||.|::..| |.:
Yeast 194 VAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKIEHLKQNIEALSIKLTPEQIKYL------ESI 252
Fly 298 VPLNL 302
||.::
Yeast 253 VPFDV 257
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345922 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.