DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and YJR096W

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:98/291 - (33%)
Similarity:153/291 - (52%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE--GVV 70
            ||:||:::|.:.||||:...::....|...:..||||.|||..|.||.|||..|...:.|  |..
Yeast     7 KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPGNH 71

  Fly    71 KREDIFLVTKLWNIFHDPERVEGICRKQLSNF-GLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDV 134
            |||:||..|||||..:..:|.:...|:.|:.. ||.||||.|:|.|:              |...
Yeast    72 KREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL--------------EGSK 122

  Fly   135 LQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEI--KPVTNQVECSPALNQKA 197
            |:      |:|::||::.|..|||:||||||:..:.:..:|...|:  |||.||:|.||.:.::.
Yeast   123 LR------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQE 181

  Fly   198 LTAFCKKNDVTLTGYTPL----GKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVI 258
            |..:||...:.:..:.||    ....||:.|           :.|:..:...|:::|:.:..|.:
Yeast   182 LADYCKSKGLVVEAFAPLCHGYKMTNPDLLK-----------VCKEVDRNPGQVLIRWSLQHGYL 235

  Fly   259 PIPKSSNTNRISENFDIFDFELTAEEMAVLD 289
            |:||:....|:..|...::|||:.|:|..||
Yeast   236 PLPKTKTVKRLEGNLAAYNFELSDEQMKFLD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 98/291 (34%)
Tas 5..297 CDD:223739 98/291 (34%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 92/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.