DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and ARA1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:120/308 - (38%)
Similarity:176/308 - (57%) Gaps:26/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNGYEMPILGLGTYNSKDN--EGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVK 71
            ||||..:|.|||||.|..:.  |.:.|||.||..||||||||:.|:.|..||:||::.:.:|.:|
Yeast    27 LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDGSIK 91

  Fly    72 REDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDD----NTLLPKNED 132
            |||:|:.||:|.:..|  .|:....:.|...||:|:||.|.|.|:.::.:.|    :.|:....|
Yeast    92 REDLFITTKVWPVLWD--EVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGISGLVKTPVD 154

  Fly   133 D---VLQLSDVDYLDTYKAMEKLV---KLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSP 191
            |   .:..:|.|||:|||.:||:.   ....||:||||||:.|.|.|::..|.:||..||||..|
Yeast   155 DSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQVETHP 219

  Fly   192 ALNQKALTAFCKKNDVTLTGYTPLGK-PKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGL 255
            .|.|..|..||..:|:.||.|:|||. ..|:::      .|.|..:|:||..|...:::.|.:..
Yeast   220 HLPQMELRKFCFMHDILLTAYSPLGSHGAPNLK------IPLVKKLAEKYNVTGNDLLISYHIRQ 278

  Fly   256 GVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLI 303
            |.|.||:|.|..|||.:.:.  ..||.:|:..|:.:  ||: .|:..|
Yeast   279 GTIVIPRSLNPVRISSSIEF--ASLTKDELQELNDF--GEK-YPVRFI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 119/305 (39%)
Tas 5..297 CDD:223739 118/300 (39%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 119/306 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16861
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.