DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AAD4

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_010038.1 Gene:AAD4 / 851354 SGDID:S000002402 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:325 Identity:59/325 - (18%)
Similarity:112/325 - (34%) Gaps:104/325 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVGYRHIDTAYFYQNEAE---VGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPE----RVEGIC- 95
            :.|...||||..||||..   :|:.::.:     ..|:.|.:.||....:...|    :....| 
Yeast    18 EAGGNCIDTANSYQNEESEIWIGEWMKSR-----KLRDQIVIATKFTGDYKKYEVGGGKSANYCG 77

  Fly    96 ----------RKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAME 150
                      |..|.....|:||:..:|.   :.|                :|.::  :...::.
Yeast    78 NHKHSLHVSVRDSLRKLQTDWIDILYVHW---WDY----------------MSSIE--EVMDSLH 121

  Fly   151 KLVKLGLVRSIGVSN--------------------FNSEQ----------------LAR----VL 175
            .||:.|.|..:|||:                    |:..|                :||    .|
Yeast   122 ILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMAL 186

  Fly   176 ANCEIKPVTNQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKY 240
            |..::.. ..:.:...|:.::      |||...|...:...|......|    .|..:|.:|:::
Yeast   187 APWDVMG-GGRFQSKKAMEER------KKNGEGLRTVSGTSKQTDKEVK----ISEALAKVAEEH 240

  Fly   241 G-KTTPQIVLRYL--VGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNL 302
            | ::...|.:.|:  ....|.|:........:.:|.:....:||.|::..|      |.::|.::
Yeast   241 GTESVTAIAIAYVRSKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIEYL------ESIIPFDV 299

  Fly   303  302
            Yeast   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 59/323 (18%)
Tas 5..297 CDD:223739 58/318 (18%)
AAD4NP_010038.1 AKR_AKR9A3_9B1-4 1..292 CDD:381373 57/316 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.