DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AAD3

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_010032.1 Gene:AAD3 / 850471 SGDID:S000000704 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:58/342 - (16%)
Similarity:111/342 - (32%) Gaps:114/342 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVGYRHIDTAYFYQNEAE---VGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPERVEG------I 94
            :.|...||.|...|||..   :|:.|:.:..     |:.|.:.||.  |..|.:...|      .
Yeast    61 EAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-----RDQIVIATKF--IKSDKKYKAGESNTANY 118

  Fly    95 C-----------RKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKA 148
            |           |..|.....|:||:..:|.   :.|:.               |..:::|   :
Yeast   119 CGNHKRSLHVSVRDSLRKLQTDWIDILYVHW---WDYMS---------------SIEEFMD---S 162

  Fly   149 MEKLVKLGLVRSIGVS----------NFNSEQLARVLANC--------------EIKPVT----- 184
            :..||:.|.|..:|||          |:.:....:...:.              :|.|:.     
Yeast   163 LHILVQQGKVLYLGVSDTPAWVVSAANYYATSYGKTPFSIYQGKWNVLNRDFERDIIPMARHFGM 227

  Fly   185 ----------NQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKK 239
                      .:.:...|:.::      :||...:..:....:.    ...:...|..:|.||::
Yeast   228 ALAPWDVMGGGRFQSKKAMEER------RKNGEGIRSFVGASEQ----TDAEIKISEALAKIAEE 282

  Fly   240 YG-KTTPQIVLRYL--VGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLN 301
            :| ::...|.:.|:  ......|..:......:.||......:||.:.:..|      |.:||.:
Yeast   283 HGTESVTAIAIAYVRSKAKNFFPSVEGGKIEDLKENIKALSIDLTPDNIKYL------ESIVPFD 341

  Fly   302 L--------IKGLNHKY 310
            :        :..|..||
Yeast   342 IGFPNNFIVLNSLTQKY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 55/324 (17%)
Tas 5..297 CDD:223739 53/319 (17%)
AAD3NP_010032.1 AKR_AKR9A3_9B1-4 17..335 CDD:381373 52/317 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.