DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AT1G59960

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_176204.1 Gene:AT1G59960 / 842290 AraportID:AT1G59960 Length:326 Species:Arabidopsis thaliana


Alignment Length:293 Identity:103/293 - (35%)
Similarity:155/293 - (52%) Gaps:23/293 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNG----YEMPILGLGTYNSKDNEG---EAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIR 62
            ||:.:.:|    :.||:||.||..|...|.   :..|..||.:||||.||:..||.|..:|:|:.
plant     7 PTLAIRSGPSGHHSMPVLGFGTAASPLPEPTMLKETVIEAIKLGYRHFDTSPRYQTEEPIGEALA 71

  Fly    63 DKIAEGVVK-REDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVG-----YKYV 121
            :.::.|:|: |.:.|:.||||........|....::.|.|..|||:|||::|.||.     ||: 
plant    72 EAVSLGLVRSRSEFFVTTKLWCADAHGGLVVPAIKRSLKNLKLDYLDLYIIHWPVSSKPGKYKF- 135

  Fly   122 DDNTLLPKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQ 186
                  |.:|||.:.:   |:...:..||:..:|||.:.||||||:.::|..:|:...|.|..||
plant   136 ------PIDEDDFMPM---DFEVVWSEMEECQRLGLAKCIGVSNFSCKKLQHILSIATIPPSVNQ 191

  Fly   187 VECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRY 251
            ||.||...|:.|...|:.||:.:|.|:.||........|..:.|..:..||:...||..|:.:|:
plant   192 VEMSPIWQQRKLRELCRSNDIVVTAYSVLGSRGAFWGTPKIMESDVLKEIAEAKEKTVAQVSMRW 256

  Fly   252 LVGLGVIPIPKSSNTNRISENFDIFDFELTAEE 284
            ....||..:.||....|:.||..|||:.||.:|
plant   257 AYEQGVSMVVKSFTKERLEENLKIFDWSLTEDE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 103/293 (35%)
Tas 5..297 CDD:223739 103/293 (35%)
AT1G59960NP_176204.1 AKR_AKR4A_4B 18..299 CDD:381350 100/282 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.