DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR1E2

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:307 Identity:140/307 - (45%)
Similarity:182/307 - (59%) Gaps:30/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPERVEGICRK 97
            |||.|||.||||.|.||||.||.|||..||.||.||.|:|||:|:.||||...|....||..|||
Human    43 AVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRK 107

  Fly    98 QLSNFGLDYIDLYLMHMPVGYK--------------------YVDDNTLLPKNEDDVLQLSDVDY 142
            .|....|:|:||||:|.|:|:|                    .|.|   ||.:|.:::..||.|:
Human   108 SLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQD---LPLDESNMVIPSDTDF 169

  Fly   143 LDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQKALTAFCKKN 205
            |||::|||.||..|||::|||||||.|||.|:|  .....||:|||:||.|.|.||.|.:||:..
Human   170 LDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSR 234

  Fly   206 DVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTNRIS 270
            ||::|.|.|||   ...:..|.|.:|.:..|||::||:..||::|:.:...||.||.|...:.|.
Human   235 DVSVTAYRPLG---GSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIK 296

  Fly   271 ENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            ||..:||||||..:|..:...:...|:....:.|  |||.|||.||:
Human   297 ENIQVFDFELTQHDMDNILSLNRNLRLAMFPITK--NHKDYPFHIEY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 131/290 (45%)
Tas 5..297 CDD:223739 130/285 (46%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 130/284 (46%)
Tas 42..314 CDD:223739 130/276 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.