DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AT5G01670

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:318 Identity:105/318 - (33%)
Similarity:161/318 - (50%) Gaps:37/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKR 72
            :|.:|:::|.:||||:.|......|.|...::.||||||||:.|.::.|||:.|:..:..| ::|
plant    17 RLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAG-LER 80

  Fly    73 EDIFLVTKLW----------------NIF-----------HDPERVEGICRKQLSNFGLDYIDLY 110
            .|:|:.:|||                |:.           ..||||....:..|....|:|:|||
plant    81 RDLFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDLY 145

  Fly   111 LMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL 175
            |:|.|:..:   :....|....|||   |.|....::.||.|.|..|||:|||.||...:|.::|
plant   146 LIHWPIRLR---EGASKPPKAGDVL---DFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLL 204

  Fly   176 ANCEIKPVTNQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKY 240
            ...|:.|...|:|..|......:..|||||::.:|.|:|||..:..   .|.|:...|..||||.
plant   205 GFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEGG---RDLIHDQTVDRIAKKL 266

  Fly   241 GKTTPQIVLRYLVGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVV 298
            .||..||::::.:..|...||||.|..||.||..:||:.:..::...|:.....:||:
plant   267 NKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 105/318 (33%)
Tas 5..297 CDD:223739 103/315 (33%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 103/309 (33%)
Tas 13..317 CDD:223739 103/309 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.