DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR4C10

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_181315.2 Gene:AKR4C10 / 818356 AraportID:AT2G37790 Length:314 Species:Arabidopsis thaliana


Alignment Length:319 Identity:118/319 - (36%)
Similarity:180/319 - (56%) Gaps:30/319 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKR 72
            :||.|.::|.:||||:.:.......||..|:.:||||||.|..|.||.|:|..::.....|||||
plant     9 ELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGLVLKKLFDGGVVKR 73

  Fly    73 EDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPV-------GYKYVDDNTLLPKN 130
            |::|:.:|||..:|||:.|.....:.|.:..|||:||||:|.||       |:|        |:|
plant    74 EEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLKKGSTGFK--------PEN 130

  Fly   131 EDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQ 195
                  :...|...|:||||.|...|..|:||||||:|::||.:|....:.|..|||||.|:..|
plant   131 ------ILPTDIPSTWKAMESLFDSGKARAIGVSNFSSKKLADLLVVARVPPAVNQVECHPSWQQ 189

  Fly   196 KALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPI 260
            ..|..|||...|.|:||:|||.|.......|.:.:|.:..:|:|.|||..|:.||:.:.:|...:
plant   190 NVLRDFCKSKGVHLSGYSPLGSPGTTWLTSDVLKNPILGGVAEKLGKTPAQVALRWGLQMGQSVL 254

  Fly   261 PKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLN--HKYYPF-SIE 316
            |||::.:||.:|||:|::.:..:.::.......|      .|::|::  |:..|: |:|
plant   255 PKSTHEDRIKQNFDVFNWSIPEDMLSKFSEIGQG------RLVRGMSFVHETSPYKSLE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 112/300 (37%)
Tas 5..297 CDD:223739 112/295 (38%)
AKR4C10NP_181315.2 AKR_AKR4C1-15 6..292 CDD:381351 113/302 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.