DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and ChlAKR

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001031505.1 Gene:ChlAKR / 818354 AraportID:AT2G37770 Length:315 Species:Arabidopsis thaliana


Alignment Length:280 Identity:113/280 - (40%)
Similarity:161/280 - (57%) Gaps:21/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKR 72
            |||.|.:.|.:||||:.:.......||..|:.:||||||.|..|.||.|:|..::....:.||||
plant     9 KLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVVKR 73

  Fly    73 EDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMP-------VGYKYVDDNTLLPKN 130
            ||:|:.:|||...|||:.|.....:.|.:..|:|:||||:|.|       ||.|        |:|
plant    74 EDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIKKGSVGIK--------PEN 130

  Fly   131 EDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQ 195
                  |..||...|:||||.|...|..|:||||||::::||.:|....:.|..|||||.|:..|
plant   131 ------LLPVDIPSTWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQ 189

  Fly   196 KALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPI 260
            ..|..|||...|.|:.|:|||.|.....|.|.:.:|.:.::|:|.||:..|:.||:.:.:|...:
plant   190 TKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVL 254

  Fly   261 PKSSNTNRISENFDIFDFEL 280
            |||:|..||.|||::||:.:
plant   255 PKSTNEGRIKENFNVFDWSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 113/280 (40%)
Tas 5..297 CDD:223739 113/280 (40%)
ChlAKRNP_001031505.1 AKR_AKR4C1-15 6..291 CDD:381351 113/280 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.