DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and akr1a1b

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005166342.1 Gene:akr1a1b / 799805 ZFINID:ZDB-GENE-050417-118 Length:351 Species:Danio rerio


Alignment Length:319 Identity:135/319 - (42%)
Similarity:191/319 - (59%) Gaps:17/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIA-EGVVKR 72
            |:.|.:||:|||||:.|:....:.||..|::.||||||.|..|.||.|:|:|.::.:. :..::|
Zfish    34 LSTGRKMPLLGLGTWKSEPGLVKQAVIWALESGYRHIDCAPIYANEPEIGEAFQETMGPDKGIRR 98

  Fly    73 EDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQL 137
            ||:|:.:||||..|.|:.||....|.|.:..|:|:||||:|.|  |.:...:|..|:.||..|..
Zfish    99 EDVFVTSKLWNTKHHPDDVEPSLLKTLKDLKLEYLDLYLIHWP--YAFQRGDTPFPRKEDGTLLY 161

  Fly   138 SDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALTAFC 202
            .|:||..|:.||||||..||||:||:|||||.|:..:|:...|||...|||..|.|.|..|.:.|
Zfish   162 DDIDYKLTWAAMEKLVGKGLVRAIGLSNFNSRQIDDILSVASIKPTVLQVESHPYLAQVELLSHC 226

  Fly   203 KKNDVTLTGYTPLGKP-----KPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPK 262
            :...:.:|.|:|||.|     .||  :|..:..|.:|.:||||.||..||::|:....||:.|||
Zfish   227 RDRGLVMTAYSPLGSPDRAWKHPD--EPVLLEEPAIAALAKKYNKTPAQIIIRWQTQRGVVTIPK 289

  Fly   263 SSNTNRISENFDIFDFELTAEEMAVLDGYHTGER-VVPLNLIKG------LNHKYYPFS 314
            |...:||.||..:|||.|.:|||:.:...|.|.| :||...:.|      ..|.:|||:
Zfish   290 SITQSRIKENIQVFDFTLESEEMSQVTALHRGWRYIVPTITVDGKSVPRDAGHPHYPFN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 130/299 (43%)
Tas 5..297 CDD:223739 128/294 (44%)
akr1a1bXP_005166342.1 ARA1 27..324 CDD:223729 127/293 (43%)
Tas 36..320 CDD:223739 124/287 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.