DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1a1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_112262.1 Gene:Akr1a1 / 78959 RGDID:68346 Length:325 Species:Rattus norvegicus


Alignment Length:324 Identity:132/324 - (40%)
Similarity:197/324 - (60%) Gaps:17/324 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |.:|.|:.|.:||::||||:.|:..:.:||:|:|:.|||||||.|..|.||.|:|:|:::.:..|
  Rat     3 ASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAG 67

  Fly    69 -VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
             .|.||::|:.:||||..|.||.||...||.|::..|:|:||||||.|..::..|:.  .|||.|
  Rat    68 KAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNP--FPKNAD 130

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKA 197
            ..::.....|.:|:||:|.||..|||:::|:|||:|.|:..||:...::|...||||.|.|.|..
  Rat   131 GTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNE 195

  Fly   198 LTAFCKKNDVTLTGYTPLGKP-----KPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            |.|.|:...:.:|.|:|||..     .||  :|..:..|.|..:|:|:|::..||:||:.|...|
  Rat   196 LIAHCQARGLEVTAYSPLGSSDRAWRHPD--EPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKV 258

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGER-VVPLNLIKG------LNHKYYPFS 314
            |.||||...:||.:|..:|||..:.|||..||..:...| :||:..:.|      ..|..|||:
  Rat   259 ICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 126/303 (42%)
Tas 5..297 CDD:223739 124/298 (42%)
Akr1a1NP_112262.1 AKR_AKR1A1-4 8..312 CDD:381332 126/307 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.