DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and LOC734139

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001039264.1 Gene:LOC734139 / 734139 -ID:- Length:324 Species:Xenopus tropicalis


Alignment Length:320 Identity:148/320 - (46%)
Similarity:194/320 - (60%) Gaps:13/320 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTY---NSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |:|::|::||:||.|||   .|..:..|...|.||||||||||.|:.|.||.|||:||..|||:|
 Frog     9 VELSDGHKMPVLGFGTYAPQKSPKHLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIGAKIADG 73

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .|||||:|...|||:.||.||||.....|.|.:..|||:||:::|.|:.:|..||.  ||.:|:.
 Frog    74 TVKREDVFYTGKLWSSFHTPERVRVCLEKSLKDLQLDYMDLFIIHNPMEFKPGDDP--LPLDENG 136

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .|...:.|..||:||:||....||||||||||||.:||..:|  ...:.|||.|||||...|||.
 Frog   137 KLIYHNTDIRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLNQS 201

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPKP----DIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            .|..|||..|:.|.||:.||..:.    |...|..:..|.:.|||||..:|..|:.:|||:..||
 Frog   202 KLLEFCKSKDIVLVGYSVLGSSRDERWIDQNSPVLLEDPVLNVIAKKLNRTPAQVAMRYLLQRGV 266

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :.:.||....||.:||.:|||:|.||:|..|||.:...|.|  :.....:|..|||..|:
 Frog   267 VVLAKSFTPARIQQNFQVFDFQLDAEDMKSLDGLNRHLRYV--DTTTWSDHPKYPFHEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 143/303 (47%)
Tas 5..297 CDD:223739 141/298 (47%)
LOC734139NP_001039264.1 ARA1 9..307 CDD:223729 142/299 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.