DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1cl

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_081858.2 Gene:Akr1cl / 70861 MGIID:1918111 Length:322 Species:Mus musculus


Alignment Length:324 Identity:139/324 - (42%)
Similarity:185/324 - (57%) Gaps:21/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSKDNEGEA-------AVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDK 64
            ::|::|:.:|:||.||:    ..||.       |.|.|||.|:||||:|||||||.|||.|||.|
Mouse     7 MELSDGHHIPVLGFGTF----VPGEVSKSMVAKATKIAIDAGFRHIDSAYFYQNEEEVGLAIRSK 67

  Fly    65 IAEGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPK 129
            :|:|.|:|||||..:||....|.||.|:....:.|....|||:||||:|.||..|  ..|.|:|.
Mouse    68 VADGTVRREDIFYTSKLPCTCHRPELVQPCLEQSLRKLQLDYVDLYLIHCPVSMK--PGNDLIPT 130

  Fly   130 NEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPA 192
            :|:..|....||..||::||||....||.:||||||||..||..:|  .....|||.|||||.|.
Mouse   131 DENGKLLFDTVDLCDTWEAMEKCKDSGLAKSIGVSNFNRRQLEMILNKPGLRYKPVCNQVECHPY 195

  Fly   193 LNQKALTAFCKKNDVTLTGYTPLGKPK----PDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLV 253
            |||..|..:||..|:.|..|..||..:    .:...|..:..|.:..:|:|:.:|...|.||||:
Mouse   196 LNQSKLLDYCKSKDIVLVAYGALGSQRCKNWIEENAPYLLEDPTLCAMAEKHKQTPALISLRYLL 260

  Fly   254 GLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            ..|::.:.||.|..||.||..:|:|.|.||:|||:|..:...|.....:|..  |..|||..|:
Mouse   261 QRGIVIVTKSFNEKRIKENLKVFEFHLPAEDMAVIDRLNRNYRYATARIISA--HPNYPFLDEY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 133/307 (43%)
Tas 5..297 CDD:223739 132/302 (44%)
Akr1clNP_081858.2 ARA1 4..309 CDD:223729 133/307 (43%)
Tas 14..297 CDD:223739 129/288 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.