DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1e1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_061347.2 Gene:Akr1e1 / 56043 MGIID:1914758 Length:301 Species:Mus musculus


Alignment Length:314 Identity:138/314 - (43%)
Similarity:189/314 - (60%) Gaps:27/314 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFLVT 79
            :|.:||||:.:...|...|||.||::||||.|.||.|.||:|||..|.:||.||||||||:|:|:
Mouse     4 IPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKREDLFVVS 68

  Fly    80 KLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLD 144
            |||...|....|:..|...|....|||:||||:|.|:|:|..:.:  :|.:.:..:..|...:||
Mouse    69 KLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEKD--IPLDRNGKVIPSHTSFLD 131

  Fly   145 TYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQKALTAFCKKNDV 207
            |::|||.||..|||:::||||||.|||.|:|  ....::|:|||:||.|.||||.|..||.|.:|
Mouse   132 TWEAMEDLVFEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFCHKRNV 196

  Fly   208 TLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTNRISEN 272
            ::|.|.|||.........|   ...:..||||:||:..||::|:.:...:|.||||...:||.||
Mouse   197 SVTAYRPLGGSGGGFHLMD---DTVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIREN 258

  Fly   273 FDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGL---------NHKYYPFSIEF 317
            ..:||||||.::|..|           |:|.|.|         ||:.|||.||:
Mouse   259 IQVFDFELTEKDMEEL-----------LSLDKNLRLATFPTTENHQDYPFHIEY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 128/288 (44%)
Tas 5..297 CDD:223739 127/283 (45%)
Akr1e1NP_061347.2 Tas 4..287 CDD:223739 131/298 (44%)
ARA1 4..282 CDD:223729 130/293 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.