DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and akr1a1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001016137.1 Gene:akr1a1 / 548891 XenbaseID:XB-GENE-1014353 Length:327 Species:Xenopus tropicalis


Alignment Length:317 Identity:136/317 - (42%)
Similarity:196/317 - (61%) Gaps:13/317 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKI-AEGVVKR 72
            |..|.::|::||||:.|...:.:.|||:|:.|||||||.|:.|.||.|||:||::.: ::..:.|
 Frog    10 LYTGQKIPLIGLGTWKSAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGSDKGLSR 74

  Fly    73 EDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQL 137
            |::|:.:||||..|.|:.||...||.|.:..|||:||||||.|..:|..|.  :.|:|.|..:|.
 Frog    75 EEVFVTSKLWNNKHHPDDVECALRKTLQDLQLDYLDLYLMHWPYAFKRGDQ--IFPQNPDGSVQY 137

  Fly   138 SDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALTAFC 202
            ...||.||:||||||||.||.::||:||||..|:..:::...:||...||||.|.|.|..|.|:|
 Frog   138 DLTDYKDTWKAMEKLVKQGLTKAIGLSNFNKRQIDDIISIATVKPAVLQVECHPYLAQNELIAYC 202

  Fly   203 KKNDVTLTGYTPLGKPKPDIQKPD---FIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSS 264
            ..:.:..|||:|||.|....:||:   .:..|.:..:||||||:..||:||:.|...|:.||||.
 Frog   203 HAHGLVFTGYSPLGSPDRSWRKPEDPVLLEEPGIIAMAKKYGKSEAQILLRWQVQRKVVSIPKSV 267

  Fly   265 NTNRISENFDIFDFELTAEEMAVLDGYHTGER-VVPLNLIKG------LNHKYYPFS 314
            ...||.:||.:|||.|:.|||.::...:...| ::||..:.|      ..|..|||:
 Frog   268 TPTRILQNFQVFDFSLSEEEMQLIGALNKNWRYIIPLITVNGKSVPRDAGHPLYPFN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 131/297 (44%)
Tas 5..297 CDD:223739 129/292 (44%)
akr1a1NP_001016137.1 AKR_AKR1A1-4 10..314 CDD:381332 132/305 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.