DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and zgc:110782

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:296 Identity:99/296 - (33%)
Similarity:162/296 - (54%) Gaps:22/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEG-EAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIA 66
            :.|:|:|.:|.:||:||||||..:|:|. :.:|..|:..|||..|||..|.|||.:|:.:::.:.
Zfish     2 IVPSVRLMSGTQMPLLGLGTYKLQDHEQLKQSVSCALQAGYRAFDTAAVYGNEAHLGQVLKELLP 66

  Fly    67 EGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNE 131
            :..:.|||:|:::||....|.....|| |.:.|.....:||||||:|.| |.:.:|.       |
Zfish    67 KYGLIREDVFIISKLAPSDHGLRAKEG-CLRSLEQLDCEYIDLYLIHWP-GMEGLDP-------E 122

  Fly   132 DDVLQLSDVDY-LDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQ 195
            |.    ...:| ..::..:|:....|..::|||||:.::.:..:||:|.:.|...|:||.|.|.|
Zfish   123 DS----RHSEYRAQSWATLEEFHASGQFKAIGVSNYTAKHIRELLASCRVPPAVLQIECQPKLIQ 183

  Fly   196 KALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPI 260
            :.|...|.:..:....|:.|||..       .:..|||..|.:..|:|..|::||:.:..|:..:
Zfish   184 RELRDLCMETGIHFQAYSSLGKGA-------LLREPEVMDIVRHCGRTPAQVLLRWALQQGISVL 241

  Fly   261 PKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGER 296
            |:||..:|:.||..:|||:|...:|..||..:.|.|
Zfish   242 PRSSQPSRVLENAQVFDFKLNETDMKRLDDLNCGTR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 99/294 (34%)
Tas 5..297 CDD:223739 99/294 (34%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 99/296 (33%)
Tas 17..271 CDD:223739 90/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.