DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c12l1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001129216.1 Gene:Akr1c12l1 / 498790 RGDID:1559604 Length:323 Species:Rattus norvegicus


Alignment Length:327 Identity:142/327 - (43%)
Similarity:183/327 - (55%) Gaps:27/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTY------NSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKI 65
            ||||:|:.:|.||.||.      .||..|   ||..|||.||.|||||..||.|.|:|:||:.||
  Rat     8 VKLNDGHFIPALGFGTSIPNEVPKSKSLE---AVHLAIDAGYHHIDTASAYQIEEEIGQAIQSKI 69

  Fly    66 AEGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPV----GYKYVDDNTL 126
            ..|||||||:|:.||||.....||.|:....|.|.|..|||.|||:||.||    |.||      
  Rat    70 KAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDKY------ 128

  Fly   127 LPKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVEC 189
            ||.::.....|..||:.||::.:||....|||:||||||||.:||.|:|  ...:.|||.|||||
  Rat   129 LPVDDKGKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVEC 193

  Fly   190 SPALNQKALTAFCKKNDVTLTGYTPLG----KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLR 250
            ...:||..|..:||..|:.|..|..||    |...|...|..:..|.:..:|||..::...|.||
  Rat   194 HLYMNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPALIALR 258

  Fly   251 YLVGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSI 315
            |||...|:|:.:|...|.:.||..:|:|:|:.|:|..|||.:...|.:....:.|  |..||||.
  Rat   259 YLVQREVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAG--HPEYPFSE 321

  Fly   316 EF 317
            |:
  Rat   322 EY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 135/310 (44%)
Tas 5..297 CDD:223739 134/305 (44%)
Akr1c12l1NP_001129216.1 ARA1 8..305 CDD:223729 134/305 (44%)
Tas 16..297 CDD:223739 126/289 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.