DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and zgc:101765

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:303 Identity:106/303 - (34%)
Similarity:158/303 - (52%) Gaps:40/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNGYEMPILGLGTYNSKDNEGE-AAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |:|.|||..:||:|||||:..:..|.. :||..|:..|||..|||..|:|||.:|.|:|..:.:.
Zfish     6 PSVLLNNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRCLLPKH 70

  Fly    69 VVKREDIFLVTKLWNIFHDPE----RVEGICRKQLSNFGLDYIDLYLMH------MPVGYKYVDD 123
            .:.|||:|:.:||     .|:    :....|:|.|...||.||||||:|      :|||.|    
Zfish    71 GLSREDVFITSKL-----GPKDQGSKARNGCQKSLEQLGLGYIDLYLIHWPGTQGLPVGDK---- 126

  Fly   124 NTLLPKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVE 188
                 :|.::..|        :::.:|:....|..|:|||||:..|.:..:|.:|::.|...|||
Zfish   127 -----RNPENRAQ--------SWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVE 178

  Fly   189 CSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLV 253
            ..|.|.|..|...||...|....|:.||...       .:.:|.|..|||:.|:|..|::||:.|
Zfish   179 FHPKLLQNDLRGLCKIRGVCFQAYSSLGTGL-------LLSNPVVLEIAKECGRTPAQVLLRWAV 236

  Fly   254 GLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGER 296
            ...:..:||||...|:.||..:||||::.|:|..|.....||:
Zfish   237 QQSIAVLPKSSQPERVKENGRLFDFEISEEDMERLSALDCGEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 106/303 (35%)
Tas 5..297 CDD:223739 106/303 (35%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 106/303 (35%)
Tas 11..271 CDD:223739 100/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.